DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and KLK12

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_062544.1 Gene:KLK12 / 43849 HGNCID:6360 Length:254 Species:Homo sapiens


Alignment Length:235 Identity:79/235 - (33%)
Similarity:115/235 - (48%) Gaps:27/235 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LSPRLDGRIVGGHRINITDAPHQVSL-QTSSHICGGSIISEEWILTAAHCTYGKTADRLKVRLGT 106
            ||.....:|..|........|.||.| :.:|..|||.:|...|:||||||    :..|..||||.
Human    14 LSQAATPKIFNGTECGRNSQPWQVGLFEGTSLRCGGVLIDHRWVLTAAHC----SGSRYWVRLGE 74

  Fly   107 SEFARSGQLLRVQKIVQHAQFNYTNVDY---------DFSLLQLAHPIKFDETKKAVKLPESQMK 162
            ...::    |...:.::|:.|:.|:..|         |..||:|..|::...:.:.:.||.... 
Human    75 HSLSQ----LDWTEQIRHSGFSVTHPGYLGASTSHEHDLRLLRLRLPVRVTSSVQPLPLPNDCA- 134

  Fly   163 YMDGEACFVSGWGNTQNLLES-REWLRQVEVPLVNQELCSEKYKQYGGVTERMICAGFLEGGKDA 226
             ..|..|.|||||.|.:.... .:.|:.:.:.:|:...|...|.  |.:|..|:|||.:. |:||
Human   135 -TAGTECHVSGWGITNHPRNPFPDLLQCLNLSIVSHATCHGVYP--GRITSNMVCAGGVP-GQDA 195

  Fly   227 CQGDSGGPMVSESGELVGVVSWGY--GCAKPDYPGVYSRV 264
            ||||||||:|. .|.|.|:||||.  .|.:...||||:.:
Human   196 CQGDSGGPLVC-GGVLQGLVSWGSVGPCGQDGIPGVYTYI 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 77/228 (34%)
Tryp_SPc 51..274 CDD:238113 77/227 (34%)
KLK12NP_062544.1 Tryp_SPc 21..236 CDD:214473 77/228 (34%)
Tryp_SPc 22..236 CDD:238113 77/227 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.