DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and CG34130

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001036759.1 Gene:CG34130 / 4379866 FlyBaseID:FBgn0083966 Length:297 Species:Drosophila melanogaster


Alignment Length:244 Identity:56/244 - (22%)
Similarity:108/244 - (44%) Gaps:39/244 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 RIVGGHRI----NITDAPHQVSLQTSSHICGGSIISEEWILTAAHCTYGKTA--DRLKVRLGTSE 108
            |..|||.:    .|.|.|        :.:||.|.:|..:.||:|:|.:...:  :.|.|.|.:|:
  Fly    48 RTSGGHAVPWLLRIVDGP--------TFVCGASYLSALYALTSANCMHSHRSQMESLSVELVSSD 104

  Fly   109 FARSGQL-------LRVQKIVQHAQFNYTNVDYDFSLLQLAHPIKFDETKKAVKL--PESQMKYM 164
            ..:..||       ..::.|:....:::.....|.::::|.:.::.:........  |.|..|.:
  Fly   105 SRQDNQLDSHDPPNALIRNIIVSKDWHWPGTFMDVAVIELTNRLRGNRNNYVTLCTNPLSSYKSL 169

  Fly   165 DGEACFVS-GWGNTQNLLESREWLRQVEVPLVNQELCSEKYKQYGGVTERMICAGFLEGGKDACQ 228
            .    .|| |.|..:|       :|..|:.::|:.:|...|..: .:.|.:.||...:...| |.
  Fly   170 S----VVSYGAGPAEN-------VRTEEIEVLNRMICDSAYGNF-LLRETVACAKEFKRSAD-CM 221

  Fly   229 GDSGGPMVSESGELVGVVSWGYGCAKPDYPGVYSRVSFARDWI-KEHSG 276
            ..:|.| |:...:|.|:|:|...|.:.:.||:::.:...:.:| |..||
  Fly   222 FSAGCP-VTAGDQLCGIVAWSPACKRSNLPGIFTDIHQVKRFILKAISG 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 52/236 (22%)
Tryp_SPc 51..274 CDD:238113 53/239 (22%)
CG34130NP_001036759.1 Trypsin 53..263 CDD:278516 49/231 (21%)
Tryp_SPc 53..256 CDD:304450 49/224 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.