DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and Gm5771

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001034086.1 Gene:Gm5771 / 436523 MGIID:3646222 Length:245 Species:Mus musculus


Alignment Length:230 Identity:99/230 - (43%)
Similarity:141/230 - (61%) Gaps:13/230 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 DGRIVGGHRINITDAPHQVSLQTSSHICGGSIISEEWILTAAHCTYGKTADRLKVRLGTSE---F 109
            |.:||||:.......|:||||.:..|.||||:|:::|:::||||.  ||  |::||||...   .
Mouse    20 DDKIVGGYTCRENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCY--KT--RIQVRLGEHNIKVL 80

  Fly   110 ARSGQLLRVQKIVQHAQFNYTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSGW 174
            ..:.|.:...||::|..||...::.|..|::|:.|:..:.....|.||.|...  .|..|.:|||
Mouse    81 EGNEQFVNAAKIIKHPNFNRKTLNNDIMLIKLSSPVTLNARVATVALPSSCAP--AGTQCLISGW 143

  Fly   175 GNTQNL-LESREWLRQVEVPLVNQELCSEKYKQYGGVTERMICAGFLEGGKDACQGDSGGPMVSE 238
            |||.:. :...:.|:.::.||:.|..|...|.  |.:|..|:||||||||||:||||||||:|. 
Mouse   144 GNTLSFGVSEPDLLQCLDAPLLPQADCEASYP--GKITGNMVCAGFLEGGKDSCQGDSGGPVVC- 205

  Fly   239 SGELVGVVSWGYGCAKPDYPGVYSRVSFARDWIKE 273
            :|||.|:||||||||..|.||||::|....|||::
Mouse   206 NGELQGIVSWGYGCALADNPGVYTKVCNYVDWIQD 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 96/224 (43%)
Tryp_SPc 51..274 CDD:238113 98/227 (43%)
Gm5771NP_001034086.1 Tryp_SPc 22..238 CDD:214473 96/224 (43%)
Tryp_SPc 23..241 CDD:238113 98/227 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 187 1.000 Domainoid score I3329
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 191 1.000 Inparanoid score I3860
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000102
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.