DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and intr

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_651633.1 Gene:intr / 43397 FlyBaseID:FBgn0039599 Length:298 Species:Drosophila melanogaster


Alignment Length:274 Identity:65/274 - (23%)
Similarity:113/274 - (41%) Gaps:54/274 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 QPVKRQRSLEDVIKNPWKLSPRLDGRIVGG-----HRINI---------------TDAPHQVS-- 67
            ||.:..|.:|.::..|::.||::..|...|     :.:.|               |:||..|.  
  Fly    37 QPYQIVRVIEYIVPYPYQRSPKISARFSSGGNKEPNSLEIIPAEIETLLTDGQATTEAPKAVKHF 101

  Fly    68 ----LQTSSHICGGSIISEEWILTAAHCTYGKTADRLKVRLGTSEFARSGQLLRVQKIVQHAQFN 128
                |..:..||.|::||...:||:|.| :.:|..:...|....:.:|| ::..|..::      
  Fly   102 VMRILYENKVICSGALISTRLVLTSALC-FPRTLRQPPPRSYKLQASRS-RIYSVANLI------ 158

  Fly   129 YTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSGWGNTQNLLESREWLRQVEVP 193
             |....|.:||.|..|:: |.....:.|.||.::..|....::           |::.||.:...
  Fly   159 -TGAIEDMALLLLHAPLE-DPFVHPIDLCESPLRRNDNVTMYM-----------SQQHLRFLRTK 210

  Fly   194 LVNQELCSEKYKQ--YGGVTERMICAGFLEGGKDA-CQGDSGGPMVSESGELVGVVSWGYGCAKP 255
            |:....|...|.|  ...:|:.|:||  |...:.. ||...|..::.:. .|.||..:|..|:..
  Fly   211 LIPNSNCKRSYAQDENAFITQTMLCA--LNSNRLVDCQTAKGDVLLHQD-RLCGVDIYGQHCSDG 272

  Fly   256 DYPG-VYSRVSFAR 268
            ...| :|:.|..||
  Fly   273 GVNGELYADVFKAR 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 58/249 (23%)
Tryp_SPc 51..274 CDD:238113 57/248 (23%)
intrNP_651633.1 Tryp_SPc 112..284 CDD:304450 48/195 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.