DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and CG5255

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster


Alignment Length:235 Identity:87/235 - (37%)
Similarity:130/235 - (55%) Gaps:21/235 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 RIVGGHRINITDAPHQVSLQ---TSSHICGGSIISEEWILTAAHCTYGKTADRLKVRLGTSEFAR 111
            |||||.......||:|:|||   :.:|.|||:||.|.||:||||||.|:.|...:|..||.:..:
  Fly    29 RIVGGEEAAAGLAPYQISLQGIGSGAHSCGGAIIDERWIITAAHCTRGRQATAFRVLTGTQDLHQ 93

  Fly   112 SG-QLLRVQKIVQHAQF---NYTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVS 172
            :| :.....:||:|:.:   .|.|   |.:||.|...|.||...:.|:|....:  :.|....::
  Fly    94 NGSKYYYPDRIVEHSNYAPRKYRN---DIALLHLNESIVFDNATQPVELDHEAL--VPGSRLLLT 153

  Fly   173 GWGNTQNL---LESREWLRQVEVPLVNQELCSEKYKQYGGVTERMICAGFLEGGKDACQGDSGGP 234
            ||| |.:|   :.:|  |:.:||..|..|.|...:.....|....:|. |.:.|:.||.||||||
  Fly   154 GWG-TLSLGGDVPAR--LQSLEVNYVPFEQCRAAHDNSTRVDIGHVCT-FNDKGRGACHGDSGGP 214

  Fly   235 MVSESGELVGVVSWGYGCAKPDYPGVYSRVSFARDWIKEH 274
            :| .:|:||.:|:||..||| .||..::.:|:..|:|:.|
  Fly   215 LV-HNGKLVALVNWGLPCAK-GYPDAHASISYYHDFIRTH 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 85/230 (37%)
Tryp_SPc 51..274 CDD:238113 85/232 (37%)
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 85/230 (37%)
Tryp_SPc 30..252 CDD:238113 85/232 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.