DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and CG31266

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster


Alignment Length:280 Identity:87/280 - (31%)
Similarity:136/280 - (48%) Gaps:26/280 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LFVLLQCSLLVLAGVCLI------PQP----VKRQRSLEDVIKNPWKLSPRLDGRIVGGHRINIT 60
            |.|||..:||.|.|....      |.|    ::|.||.|.|        |:  ||::||......
  Fly     7 LTVLLGLTLLALQGPTEAMRMRGEPLPGLANIERHRSTEAV--------PQ--GRVIGGTTAAEG 61

  Fly    61 DAPHQVSLQT--SSHICGGSIISEEWILTAAHCTYGKTADRLKVRLGTSE-FARSGQLLRVQKIV 122
            :.|...|:|.  |.|:||..|:.|.|:||||.|..|.....|.|..||.: :........|.:|.
  Fly    62 NWPWIASIQNAYSYHLCGAIILDETWVLTAASCVAGLRPLNLLVVTGTVDWWDLYAPYYTVSQIH 126

  Fly   123 QHAQFNYTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSGWGNTQNLLESREWL 187
            .|..|:......|.:||||:..|:|::..|.:.|.:.. :..:|:....:|||:::.:.....:|
  Fly   127 VHCNFDKPLYHNDIALLQLSSKIEFNDVTKNITLADID-ELEEGDKLTFAGWGSSEAMGTYGRYL 190

  Fly   188 RQVEVPLVNQELCSEKYKQYGGVTERMICAGFLEGGKDACQGDSGGPMVSESGELVGVVSWGYGC 252
            ::.....:..:.|.||.:....|....:|.. ::.|:.||.||:|||::.|...|||:.:||..|
  Fly   191 QEASGTYLPVDACREKLQNQDDVDLGHVCVQ-MDAGQGACHGDTGGPLIDEQQRLVGIGNWGVPC 254

  Fly   253 AKPDYPGVYSRVSFARDWIK 272
            .: .||.||:|.:|..|||:
  Fly   255 GR-GYPDVYARTAFYHDWIR 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 68/223 (30%)
Tryp_SPc 51..274 CDD:238113 69/225 (31%)
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 68/223 (30%)
Tryp_SPc 52..275 CDD:238113 69/225 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.