DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and CG17475

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:273 Identity:88/273 - (32%)
Similarity:141/273 - (51%) Gaps:19/273 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLQCSLLVLAGVCLIPQPVKRQRSL-EDVIKNPWKLSP----RLDGRIVGGHRINITDAPHQVSL 68
            ::|..:::||..|..|....|...| ||.::  | :|.    ....|::.|..:.:.:|.:|:||
  Fly     6 VVQILVILLACTCYKPISAVRLAQLSEDQLE--W-ISKAEGVNFQNRVINGEDVQLGEAKYQISL 67

  Fly    69 Q--TSSHICGGSIISEEWILTAAHCTYGKTADRLKVRLGTSEFARSGQLLRVQKIVQHAQFNYTN 131
            |  ...|||||.||.|..:||||||.||.....|:|..||.|:.:...:..|::...|.  ||.:
  Fly    68 QGMYGGHICGGCIIDERHVLTAAHCVYGYNPTYLRVITGTVEYEKPDAVYFVEEHWIHC--NYNS 130

  Fly   132 VDY--DFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSGWGNTQNLLESREWLRQVEVPL 194
            .||  |.:|::|...|||:|..:..:||.:.:  .:|....::|||:|:...::.:.|::..:..
  Fly   131 PDYHNDIALIRLNDTIKFNEYTQPAELPTAPV--ANGTQLLLTGWGSTELWGDTPDILQKAYLTH 193

  Fly   195 VNQELCSEKYKQYGGVTERMICAGFLEGGKDACQGDSGGPMVSESGELVGVVSWGYGCAKPDYPG 259
            |....|.|............||. ...||:.||.||||||: :.:|.|.|:|:|||.||. ..|.
  Fly   194 VVYSTCQEIMNNDPSNGPCHICT-LTTGGQGACHGDSGGPL-THNGVLYGLVNWGYPCAL-GVPD 255

  Fly   260 VYSRVSFARDWIK 272
            .::.|.:..:||:
  Fly   256 SHANVYYYLEWIR 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 75/224 (33%)
Tryp_SPc 51..274 CDD:238113 76/226 (34%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 75/224 (33%)
Tryp_SPc 50..269 CDD:238113 76/226 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.