DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and CG17477

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster


Alignment Length:235 Identity:82/235 - (34%)
Similarity:119/235 - (50%) Gaps:16/235 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 LDGRIVGGHRINITDAPHQVSLQT--SSHICGGSIISEEWILTAAHCTYGKTADRLKVRLGTSEF 109
            |:..||||......|||:||||||  .||:|||:|||:.||:||.||..|....||:|..||..:
  Fly    23 LEHFIVGGQNAAEGDAPYQVSLQTLLGSHLCGGAIISDRWIITAGHCVKGYPTSRLQVATGTIRY 87

  Fly   110 ARSGQLLRVQKIVQHAQFNYTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSGW 174
            |..|.:.....|..|..::......|..||.|...|.|:...:||:||.|.......|..| :||
  Fly    88 AEPGAVYYPDAIYLHCNYDSPKYQNDIGLLHLNESITFNALTQAVELPTSPFPRGASELVF-TGW 151

  Fly   175 GNTQNLLESREWLRQVEVPLVNQELCSEKYKQYGGVTERM------ICAGFLEGGKDACQGDSGG 233
            |:..........|::|:...:|...|......|    |.:      ||| :.:....||.|||||
  Fly   152 GSQSAAGSLPSQLQRVQQQHLNSPACESMMSAY----EDLELGPCHICA-YRQANIGACHGDSGG 211

  Fly   234 PMVSESGELVGVVSWGYGCAKPDYPGVYSRVSFARDWIKE 273
            |:|.: |.|||::::...||: ..|.::..:.:.|||:::
  Fly   212 PLVHQ-GTLVGILNFFVPCAQ-GVPDIFMNIMYYRDWMRQ 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 80/228 (35%)
Tryp_SPc 51..274 CDD:238113 81/231 (35%)
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 81/231 (35%)
Tryp_SPc 27..246 CDD:214473 79/226 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.