DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and CG12951

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster


Alignment Length:276 Identity:94/276 - (34%)
Similarity:143/276 - (51%) Gaps:33/276 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LQCSLLVLAGVCLIPQPVKRQRSLEDVIKNPWKLSPRLDGRIVGGHRINITDAPHQVSLQT--SS 72
            |..||:|:..|..:.|                 .:|.: .|:|.|...::...|..|||::  .|
  Fly     7 LSLSLIVILAVTTVGQ-----------------AAPSI-SRVVNGTDSSVLKYPFVVSLRSYDGS 53

  Fly    73 HICGGSIISEEWILTAAHCTYGKTADRLKVRLGTSEFARSG-QLLRVQKIVQHAQFNYTNVD-YD 135
            |.|||||||:.:::||||||.|:.||.|.::.|.:..:..| .::.::||:||..|:.|..: .|
  Fly    54 HSCGGSIISKHFVMTAAHCTNGRPADTLSIQFGVTNISAMGPNVVGIKKIIQHEDFDPTRQNAND 118

  Fly   136 FSLLQLAHPIKFDETKKA-VKLPESQMKYMDGEA---CFVSGWGNTQNLLESREWLRQVEVPLVN 196
            .|||.:..|.:||....| |:||.........:|   ..:.|||........::.|::|.:.:.:
  Fly   119 ISLLMVEEPFEFDGVSVAPVELPALAFAVPQSDAGVEGVLIGWGLNDTYGSVQDTLQEVSLKIYS 183

  Fly   197 QELCSEKYKQYGGVTERM--ICAGFLEGGKDACQGDSGGPMVSESGELVGVVSWGY-GCAKPDYP 258
            .|.|:.:   :.|.|:..  ||.|..||||..|.||||||:: .:|:.||:|||.. .|....||
  Fly   184 DEECTSR---HNGQTDPKYHICGGVDEGGKGQCSGDSGGPLI-YNGQQVGIVSWSIKPCTVAPYP 244

  Fly   259 GVYSRVSFARDWIKEH 274
            |||.:||...||||.:
  Fly   245 GVYCKVSQYVDWIKSN 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 84/231 (36%)
Tryp_SPc 51..274 CDD:238113 86/233 (37%)
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 84/231 (36%)
Tryp_SPc 30..260 CDD:238113 86/233 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
33.010

Return to query results.
Submit another query.