DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and Try10

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001004097.1 Gene:Try10 / 408247 RGDID:1359400 Length:246 Species:Rattus norvegicus


Alignment Length:230 Identity:99/230 - (43%)
Similarity:142/230 - (61%) Gaps:13/230 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 DGRIVGGHRINITDAPHQVSLQTSSHICGGSIISEEWILTAAHCTYGKTADRLKVRLG---TSEF 109
            |.:||||:.......|:||||.:..|.||||:|:|:|:::||||    ...|::||||   .:..
  Rat    21 DDKIVGGYTCQENSVPYQVSLNSGYHFCGGSLINEQWVVSAAHC----YKSRIQVRLGEHNINVL 81

  Fly   110 ARSGQLLRVQKIVQHAQFNYTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSGW 174
            ..:.|.:...||::|..|....::.|..|::|:.|:|.:.....|.||.|...  .|..|.:|||
  Rat    82 EGNEQFVNAAKIIKHPNFIRKTLNNDIMLIKLSSPVKLNSRVATVALPSSCAP--AGTQCLISGW 144

  Fly   175 GNTQNL-LESREWLRQVEVPLVNQELCSEKYKQYGGVTERMICAGFLEGGKDACQGDSGGPMVSE 238
            |||.:. :...:.|:.::.||:.|..|...|.  |.:|:.|:||||||||||:||||||||:|. 
  Rat   145 GNTLSFGVNEPDLLQCLDAPLLPQADCEASYP--GKITDNMVCAGFLEGGKDSCQGDSGGPVVC- 206

  Fly   239 SGELVGVVSWGYGCAKPDYPGVYSRVSFARDWIKE 273
            :|||.|:||||||||.||.||||::|....|||::
  Rat   207 NGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQD 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 96/224 (43%)
Tryp_SPc 51..274 CDD:238113 98/227 (43%)
Try10NP_001004097.1 Tryp_SPc 23..239 CDD:214473 96/224 (43%)
Tryp_SPc 24..242 CDD:238113 98/227 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000102
OrthoInspector 1 1.000 - - mtm8983
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.720

Return to query results.
Submit another query.