DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and Tmprss11c

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001003979.1 Gene:Tmprss11c / 408213 RGDID:1302967 Length:418 Species:Rattus norvegicus


Alignment Length:235 Identity:88/235 - (37%)
Similarity:138/235 - (58%) Gaps:9/235 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 RIVGGHRINITDAPHQVSLQTSS-HICGGSIISEEWILTAAHCTYGKTADRLKVRLGTSEFARSG 113
            ::.||......:.|.|.|||.:: |.||.::||..|::||||| :.::|:....::.........
  Rat   186 KVAGGQDAEEGEWPWQASLQQNNVHRCGATLISNSWLITAAHC-FVRSANPKDWKVSFGFLLSKP 249

  Fly   114 QLLR-VQKIVQHAQFNYTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSGWGNT 177
            |..| |:.||.|..::|...:.|.::::|:.|:.::...:...|||:..|:.......|:|||..
  Rat   250 QAQRAVKSIVIHENYSYPAHNNDIAVVRLSSPVLYENNIRRACLPEATQKFPPNSDVVVTGWGTL 314

  Fly   178 QNLLESREWLRQVEVPLVNQELCSEKYKQYGGV-TERMICAGFLEGGKDACQGDSGGPMVSESGE 241
            ::..:|...|::..|.:::.:.|:.. |.|||| |..|:|||||||..||||||||||:|||..:
  Rat   315 KSDGDSPNILQKGRVKIIDNKTCNSG-KAYGGVITPGMLCAGFLEGRVDACQGDSGGPLVSEDSK 378

  Fly   242 ----LVGVVSWGYGCAKPDYPGVYSRVSFARDWIKEHSGV 277
                |.|:||||..||.|:.||||:||:..||||...:|:
  Rat   379 GIWFLAGIVSWGDECALPNKPGVYTRVTHYRDWISSKTGL 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 85/227 (37%)
Tryp_SPc 51..274 CDD:238113 87/229 (38%)
Tmprss11cNP_001003979.1 SEA 62..157 CDD:279699
Tryp_SPc 186..412 CDD:214473 85/227 (37%)
Tryp_SPc 187..415 CDD:238113 87/229 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.