DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and Klk4

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001004101.1 Gene:Klk4 / 408210 RGDID:1303228 Length:256 Species:Rattus norvegicus


Alignment Length:258 Identity:74/258 - (28%)
Similarity:115/258 - (44%) Gaps:38/258 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 KNPW-------------KLSPRLDGRIVGGHRINITDAPHQVSL--QTSSHICGGSIISEEWILT 87
            :.||             ..:..:..||:.|........|.|.:|  :.::..|.|.::..:|:|:
  Rat     6 RTPWGWFLGYLILEVTGSSASSISSRIIQGQDCLPHSQPWQAALFSEDNAFFCSGVLVHPQWVLS 70

  Fly    88 AAHCTYGKTADRLKVRLGTSEFARS----GQLLRVQKIVQHAQFNYTNVDYDFSLLQLAHPIKFD 148
            ||||    ..|...|.||......|    .::|.....:||..:|..:...|..|::|...:.  
  Rat    71 AAHC----IQDSYTVGLGLHNLEGSQEPGSRMLEAHLSIQHPNYNDPSFANDLMLIKLNESVM-- 129

  Fly   149 ETKKAVKLPESQMKYMDGEACFVSGWGNTQN-LLESREWLRQVEVPLVNQELCSEKYKQYGGVTE 212
            |:....::|.:......|:.|.|||||..:| .|.|  .|:.|.:.:.::|.|...|.....:: 
  Rat   130 ESNTIRRIPVASQCPTPGDTCLVSGWGRLKNGKLPS--LLQCVNLSVASEETCRLLYDPVYHLS- 191

  Fly   213 RMICAGFLEGG---KDACQGDSGGPMVSESGELVGVVSWGYG-CAKPDYPGVYSRVSFARDWI 271
             |.|||   ||   ||.|.||||||:|. :..|.|:||.|.| |.:|..|.||:.:....:||
  Rat   192 -MFCAG---GGPDRKDTCNGDSGGPIVC-NRSLQGLVSMGQGECGQPGIPSVYTNLCKFTNWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 70/231 (30%)
Tryp_SPc 51..274 CDD:238113 71/232 (31%)
Klk4NP_001004101.1 Tryp_SPc 35..249 CDD:238113 68/227 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.