DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and CG11037

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_649272.1 Gene:CG11037 / 40317 FlyBaseID:FBgn0037038 Length:292 Species:Drosophila melanogaster


Alignment Length:240 Identity:79/240 - (32%)
Similarity:122/240 - (50%) Gaps:22/240 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 SPRLDGRIVGGHRINITDAPHQVS--LQTSSHICGGSIISEEWILTAAHCTYGK-TADRLKVRLG 105
            ||. :.|::|||..........::  |.....:|||::::|..:||||||..|: .|....|..|
  Fly    56 SPH-ETRVIGGHVTTNAKLGGYLTALLYEDDFVCGGTLLNENIVLTAAHCFLGRMKASEWIVAAG 119

  Fly   106 TSEFARSGQLLRVQKIVQHAQFNYTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACF 170
            .|...:.|....|:..:...||...:::.|.:::.|..|:|   .|....|....:....|....
  Fly   120 ISNLNQKGIRRHVKDFILSEQFREDDMNMDVAVVLLKTPLK---AKNIGTLSLCSVSLKPGVELV 181

  Fly   171 VSGWGNT-------QNLLESREWLRQVEVPLVNQELCSEKYKQYGGVTERMICAGFLEGGKDACQ 228
            |||||.|       .||      ||.|.||:::::.|...|:....:|:.||||..| |.||||.
  Fly   182 VSGWGMTAPRGRGPHNL------LRTVTVPIIHKKNCRAAYQPTAKITDSMICAAVL-GRKDACT 239

  Fly   229 GDSGGPMVSESGELVGVVSWGYGCAKPDYPGVYSRVSFARDWIKE 273
            .|||||:|.:. ::.|:||:|.|||...|||||:.|.:.:.:|::
  Fly   240 FDSGGPLVFKK-QVCGIVSFGIGCASNRYPGVYTDVMYVKPFIEK 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 76/230 (33%)
Tryp_SPc 51..274 CDD:238113 76/233 (33%)
CG11037NP_649272.1 Tryp_SPc 61..281 CDD:214473 76/230 (33%)
Tryp_SPc 62..283 CDD:238113 76/231 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.