DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and CG32374

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster


Alignment Length:234 Identity:89/234 - (38%)
Similarity:129/234 - (55%) Gaps:16/234 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 LDGRIVGGHRINITDAPHQVSLQTSSH-ICGGSIISEEWILTAAHCTYGKTADRLKVRLGTSEFA 110
            |..|||.|.:|..:.||:|.:|..::: |||..|::..|||||.||..|... |..||.|:::..
  Fly    70 LPTRIVNGKKIKCSRAPYQCALHYNNYFICGCVILNRRWILTAQHCKIGNPG-RYTVRAGSTQQR 133

  Fly   111 RSGQLLRVQKIVQHAQFNYTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFV-SGW 174
            |.|||..|||.|.|..::...:..|..:::|..|:......:.||||.::.|..  ..|:: |||
  Fly   134 RGGQLRHVQKTVCHPNYSEYTMKNDLCMMKLKTPLNVGRCVQKVKLPSTRTKRF--PKCYLASGW 196

  Fly   175 G----NTQNLLESREWLRQVEVPLVNQELCSEKYKQYG-GVTERMICAGFLEGGKDACQGDSGGP 234
            |    |.||:   :.:||.|.|..|::..|.:.|:..| .:.::||||  ....:|.|.||||||
  Fly   197 GLTSANAQNV---QRYLRGVIVCKVSRAKCQQDYRGTGIKIYKQMICA--KRKNRDTCSGDSGGP 256

  Fly   235 MVSESGELVGVVSWGYGCAKPDYPGVYSRVSFARDWIKE 273
            :| .:|.|.|:.|:|.|||...|||||..|.....|||:
  Fly   257 LV-HNGVLYGITSFGIGCASAKYPGVYVNVLQYTRWIKK 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 85/227 (37%)
Tryp_SPc 51..274 CDD:238113 87/230 (38%)
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 85/227 (37%)
Tryp_SPc 74..295 CDD:238113 87/230 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443110
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
65.850

Return to query results.
Submit another query.