DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and CG16998

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster


Alignment Length:234 Identity:80/234 - (34%)
Similarity:119/234 - (50%) Gaps:15/234 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LSPRLDGRIVGGHRINITDAPHQVSLQT-SSHICGGSIISEEWILTAAHCTYGKTADRLKVRLGT 106
            |||:  .|||||..:.|...|...|:.. .::.|..::|:..|::||.||.  :..|...||.|:
  Fly    19 LSPQ--ERIVGGVEVPIHLTPWLASITVHGNYSCSSALITSLWLVTAGHCV--QYPDSYSVRAGS 79

  Fly   107 SEFARSGQLLRVQKIVQHAQFNYTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFV 171
            :.....||...|..::.|..||...::.|.:||:|..........:.||||...:..:. ....|
  Fly    80 TFTDGGGQRRNVVSVILHPDFNLRTLENDIALLKLDKSFTLGGNIQVVKLPLPSLNILP-RTLLV 143

  Fly   172 SGWGN---TQNLLESREWLRQVEVPLVNQELCSEKYKQ-YGGVTERMICAGFLEGGKDACQGDSG 232
            :||||   |.:  ||...||...|.::||.||...|.. :..:|:.|:||.  ..|:|.|.||||
  Fly   144 AGWGNPDATDS--ESEPRLRGTVVKVINQRLCQRLYSHLHRPITDDMVCAA--GAGRDHCYGDSG 204

  Fly   233 GPMVSESGELVGVVSWGYGCAKPDYPGVYSRVSFARDWI 271
            .|:| ..|...|:||:.:|||.|.:||||:|::....||
  Fly   205 APLV-HRGSSYGIVSFAHGCADPHFPGVYTRLANYVTWI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 75/225 (33%)
Tryp_SPc 51..274 CDD:238113 76/226 (34%)
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 75/225 (33%)
Tryp_SPc 25..242 CDD:238113 74/224 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.