DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and CG32277

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_728835.1 Gene:CG32277 / 38393 FlyBaseID:FBgn0052277 Length:261 Species:Drosophila melanogaster


Alignment Length:259 Identity:82/259 - (31%)
Similarity:115/259 - (44%) Gaps:56/259 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 GRIVGGHRINITDAPHQVSLQTSSHI-CGGSIISEEWILTAAHCTYGK-------TADRLKVRLG 105
            |:|.||....:.|....|:|:..... |||.|||...:||||||..|:       |....:..||
  Fly    25 GKIFGGKTTLVKDHSFLVNLRRGGKFRCGGVIISPNCVLTAAHCLEGRYQQVRDLTVHAQQQCLG 89

  Fly   106 TS---EFARSGQLLRVQKIVQHAQFNY---TNVDYDFSLLQLAHPIKFDETKKAVKL------PE 158
            ..   |..||...:.:..       ||   ..:|.|.::::|:.|.........||:      |.
  Fly    90 DDMPPEHVRSAWYVGLSP-------NYCAQRGLDSDLAVIRLSRPFDIAGNASLVKIDYNDLPPH 147

  Fly   159 SQMKYMDGEACFVSGWGNTQNLLESREW---LRQVEVPLVNQELCSEKYKQYGG----VTERMIC 216
            |.:.        |.|||....  :...|   |::..|.|::...|   .|..|.    ||..|.|
  Fly   148 SNLT--------VLGWGAINE--QGHNWNQCLQEANVKLISHREC---IKSVGSGWQKVTNNMFC 199

  Fly   217 AGFLEGGKDACQGDSGGPMVSESGELVGVVSWGYGCAKPDYPGVYSRVS------FARDWIKEH 274
            | ..:..:||||||||||.: .:|..||:|||||||.. .|||||:|:|      :.:|:|:.|
  Fly   200 A-LGKNARDACQGDSGGPAI-YAGRSVGIVSWGYGCGS-GYPGVYTRLSSPSITYWLKDFIERH 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 79/253 (31%)
Tryp_SPc 51..274 CDD:238113 80/255 (31%)
CG32277NP_728835.1 Tryp_SPc 26..246 CDD:214473 77/242 (32%)
Tryp_SPc 27..246 CDD:238113 77/241 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.