DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and KLKB1

DIOPT Version :10

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_011530232.1 Gene:KLKB1 / 3818 HGNCID:6371 Length:649 Species:Homo sapiens


Alignment Length:238 Identity:92/238 - (38%)
Similarity:145/238 - (60%) Gaps:18/238 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 RIVGGHRINITDAPHQVSLQ----TSSHICGGSIISEEWILTAAHCTYG-KTADRLKVR---LGT 106
            |||||...:..:.|.|||||    ...|:||||:|..:|:||||||..| ...|..::.   |..
Human   401 RIVGGTNSSWGEWPWQVSLQVKLTAQRHLCGGSLIGHQWVLTAAHCFDGLPLQDVWRIYSGILNL 465

  Fly   107 SEFARSGQLLRVQKIVQHAQFNYTNVDYDFSLLQLAHPIKFDETKKAVKLP---ESQMKYMDGEA 168
            |:..:.....::::|:.|..:..:..::|.:|::|..|:.:.|.:|.:.||   ::...|.:   
Human   466 SDITKDTPFSQIKEIIIHQNYKVSEGNHDIALIKLQAPLNYTEFQKPICLPSKGDTSTIYTN--- 527

  Fly   169 CFVSGWGNTQNLLESREWLRQVEVPLVNQELCSEKYKQYGGVTERMICAGFLEGGKDACQGDSGG 233
            |:|:|||.::...|.:..|::|.:|||..|.|.::|:.| .:|:||:|||:.|||||||:|||||
Human   528 CWVTGWGFSKEKGEIQNILQKVNIPLVTNEECQKRYQDY-KITQRMVCAGYKEGGKDACKGDSGG 591

  Fly   234 PMVSESG---ELVGVVSWGYGCAKPDYPGVYSRVSFARDWIKE 273
            |:|.:..   .|||:.|||.|||:.:.||||::|:...|||.|
Human   592 PLVCKHNGMWRLVGITSWGEGCARREQPGVYTKVAEYMDWILE 634

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 51..274 CDD:238113 91/237 (38%)
KLKB1XP_011530232.1 APPLE 21..104 CDD:128519
APPLE 111..194 CDD:128519
APPLE 212..295 CDD:128519
APPLE 303..386 CDD:128519
Tryp_SPc 402..632 CDD:238113 88/233 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.