DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and CG3650

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_611971.1 Gene:CG3650 / 37974 FlyBaseID:FBgn0035070 Length:249 Species:Drosophila melanogaster


Alignment Length:239 Identity:77/239 - (32%)
Similarity:128/239 - (53%) Gaps:25/239 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 KLSPRLDG------RIVGGHRINITDAPHQVSLQTSSHICGGSIISEEWILTAAHCTYGKTADRL 100
            ::.||:.|      ..|||..:|:.        ...:..||||:::...::|||||..|..|.|:
  Fly    21 QIQPRIVGGTTTTLSAVGGFVVNLR--------YDGTFYCGGSLVTSSHVVTAAHCLKGYQASRI 77

  Fly   101 KVRLGTSEFARSGQLLRVQKIVQHAQFNYTNVDYDFSLLQLAHPIKFDETKKAV-KLPESQMKYM 164
            .|:.|.|:.::||.:.||.:......|:.:::::|..:::|...:    |...: .:|..|:::.
  Fly    78 TVQGGVSKLSQSGVVRRVARYFIPNGFSSSSLNWDVGVIRLQSAL----TGSGITTIPLCQVQWN 138

  Fly   165 DGEACFVSGWGNTQ--NLLESREWLRQVEVPLVNQELCSEKYKQYGGVTERMICAGFLEGGKDAC 227
            .|....|||||.|:  |...|.: ||.|.:.|:.:::|...|:....:|....||  ..||||:|
  Fly   139 PGNYMRVSGWGTTRYGNSSPSNQ-LRTVRIQLIRKKVCQRAYQGRDTLTASTFCA--RTGGKDSC 200

  Fly   228 QGDSGGPMVSESGELVGVVSWGYGCAKPDYPGVYSRVSFARDWI 271
            .|||||.::.:: :|.|:||||.|||...|||||:.|...|.:|
  Fly   201 SGDSGGGVIFKN-QLCGIVSWGLGCANAQYPGVYTSVHRVRSFI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 73/223 (33%)
Tryp_SPc 51..274 CDD:238113 74/224 (33%)
CG3650NP_611971.1 Tryp_SPc 25..243 CDD:214473 75/233 (32%)
Tryp_SPc 26..243 CDD:238113 74/232 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.