DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and CG13430

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster


Alignment Length:234 Identity:100/234 - (42%)
Similarity:143/234 - (61%) Gaps:9/234 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 DGRIVGGHRINITDAPHQVSLQTSS-HICGGSIISEEWILTAAHCT--YGKTADRLKVRLGTSEF 109
            |||||||...:||..|||||||..: |.|||:|||...|||||||.  |.| .....:|.|:|::
  Fly    29 DGRIVGGWETHITFFPHQVSLQLGTRHACGGTIISPNIILTAAHCVLEYSK-PQYYVIRAGSSDW 92

  Fly   110 ARSGQLLRVQKIVQHAQF-NYTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSG 173
            .:.|..:||:||:.|.:| :.|.::.|.:::||..|:.:.:..:.:.|..|:...|.....||||
  Fly    93 TKGGSYIRVKKIIPHPEFHDPTRMNNDIAIVQLQQPLVYSQDIRPISLATSKDIIMPTAQLFVSG 157

  Fly   174 WGNTQ-NLLESREWLRQVEVPLVNQELCSEKYKQYGGVTERMICAGFLEGGKDACQGDSGGPMVS 237
            ||:|. :.::..:.||...|.|.:|..|:..|...|.||..|.|||...||:|:||||||||:|:
  Fly   158 WGSTSISQMQPEKRLRYTVVHLRDQNQCARNYFGAGTVTNTMFCAGTQAGGRDSCQGDSGGPLVT 222

  Fly   238 ESG---ELVGVVSWGYGCAKPDYPGVYSRVSFARDWIKE 273
            ...   :|.|:||||:|||...:||:|::||...|||.:
  Fly   223 SIDGRLKLYGIVSWGFGCANAMFPGIYTKVSAYDDWIAQ 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 96/228 (42%)
Tryp_SPc 51..274 CDD:238113 97/231 (42%)
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 96/228 (42%)
Tryp_SPc 32..262 CDD:238113 97/231 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443347
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000102
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.