DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and CG32270

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster


Alignment Length:240 Identity:92/240 - (38%)
Similarity:131/240 - (54%) Gaps:14/240 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 KLSPRLDGRIVGGHRINITDAPHQVSLQTSSHI-CGGSIISEEWILTAAHCTYGKTADRLKVRLG 105
            :|..|...||||||..::...||.|:::...:. ||||:::...:||||||..........||.|
  Fly    22 ELELRRSPRIVGGHPSDVWHQPHMVNIRRRGNFECGGSLVTPRCVLTAAHCLNDGNPSDFVVRGG 86

  Fly   106 TSEFARSGQLLRVQKIVQHAQFNYTNVDYDFSLLQLAHPIKFDETKK---AVKLPESQMKYMDGE 167
            .:..:.......|:||:..:.::.|.:|:|.:||||..|::....|.   ||:.|.      .|.
  Fly    87 VTYLSDMRNSRYVRKILMPSAYSRTTLDHDVALLQLKQPLQASIAKPISLAVRSPR------PGS 145

  Fly   168 ACFVSGWGNTQNLLES-REWLRQVEVPLVNQELCSEKYKQYGGVTERMICAGFLEGGKDACQGDS 231
            ...|||||.|.:...| ...|:.|.|.::.|..|.:.|:.|..:|..|.||. :.|.||||.|||
  Fly   146 FVRVSGWGLTDSSSTSLPNQLQSVHVQVMPQRECRDLYRGYRNITSSMFCAS-VPGLKDACAGDS 209

  Fly   232 GGPMVSESGELVGVVSWG--YGCAKPDYPGVYSRVSFARDWIKEH 274
            |||:|:.:|.||||||||  :.||..|.|||||.||:..|||.::
  Fly   210 GGPVVNSNGILVGVVSWGRAHRCAARDSPGVYSDVSYLSDWIADN 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 88/227 (39%)
Tryp_SPc 51..274 CDD:238113 89/229 (39%)
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 88/227 (39%)
Tryp_SPc 31..254 CDD:238113 89/229 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.