DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and CG9897

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001286753.2 Gene:CG9897 / 37651 FlyBaseID:FBgn0034807 Length:265 Species:Drosophila melanogaster


Alignment Length:272 Identity:82/272 - (30%)
Similarity:135/272 - (49%) Gaps:44/272 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LEDVIKNPWKLSPRLDGRIVGGHRINITDAPHQVSLQTSSHI-CGGSIISEEWILTAAHCTYGKT 96
            |..::..||....  |.||:.|:.:||.|||...|:..:|.: |||:|||:.:|||||.|..|.:
  Fly     7 LLQIVALPWLALG--DQRIINGNTVNIKDAPWYASIIVNSKLKCGGAIISKNYILTAAKCVDGYS 69

  Fly    97 ADRLKVRLGTSEFARSGQLLRVQKIVQHAQFNYTNVDYDFSLLQLAHPIK-FDETK---KAVKLP 157
            |..::||||||....||.:..:.|:..|:|::....|.:.:||:....:. .||.|   :|.|:|
  Fly    70 ARSIQVRLGTSSCGTSGSIAGICKVKVHSQYSSWRFDNNLALLKTCELLNTTDEIKPIERADKVP 134

  Fly   158 ESQMKYMDGEACFVSGWGNTQN-----LLESR-------------EWLRQVEVPLVNQELCSEKY 204
            :      |.....|:|.|....     :|:.|             ..|...:|.:::|:.|:..:
  Fly   135 D------DNSRANVTGCGGRSGNFLDLILDLRISSGIEEKCFQLPVQLHGTQVRILSQKQCAADW 193

  Fly   205 K-----QYGGVTERMICAGFLEGGKDACQGDSGGPMVSESGELVGVVSWGYGCA-KPDYPGVYSR 263
            |     ...|:::..||.  ...||.||..|.|.|:|.:: :|||::|.. ||: |||   ||:.
  Fly   194 KVIPFYLLKGISDLTICT--KSPGKGACSTDRGSPLVIDN-KLVGILSRA-GCSIKPD---VYAN 251

  Fly   264 VSFARDWIKEHS 275
            :....:|:..::
  Fly   252 ILGHTNWLDSNT 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 77/249 (31%)
Tryp_SPc 51..274 CDD:238113 77/251 (31%)
CG9897NP_001286753.2 Tryp_SPc 22..258 CDD:214473 77/248 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.