DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and CG8299

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster


Alignment Length:289 Identity:100/289 - (34%)
Similarity:147/289 - (50%) Gaps:50/289 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LALRLFVLLQCSLLVLAGVCLIPQPVKRQRSLEDVIKNPWKLSPRLDGRIVGGHRINITDAPHQV 66
            |.|.||:|....:::|..                        |..:...||||.:.:|.|.|:||
  Fly     3 LRLGLFLLAALGVVILTD------------------------SASISTHIVGGDQADIADFPYQV 43

  Fly    67 SLQTSS----HICGGSIISEEWILTAAHCTYGKTADRLKVRLGTSEFA-RSGQLLRVQKIVQHAQ 126
            |::..:    |||||||.:...::|||||..|:.|..:::..|.:..| ...|.::|.|::.||.
  Fly    44 SVRLETYMLLHICGGSIYAPRVVITAAHCIKGRYASYIRIVAGQNSIADLEEQGVKVSKLIPHAG 108

  Fly   127 FNYTNVDYDFSLLQLAHPIKFDETKK----AVKLPESQMKYMDGEACFVSGWGNTQNLLESRE-- 185
            :|......|..|:....|:::....:    |::.|.|      |....|||||..   .|..|  
  Fly   109 YNKKTYVNDIGLIITREPLEYSALVQPIAVALEAPPS------GAQAVVSGWGKR---AEDDEAL 164

  Fly   186 --WLRQVEVPLVNQELCSEKY--KQYGGVTERMICAGFLEGGKDACQGDSGGPMVSESGELVGVV 246
              .||.||:.::.:..|..:|  |.| .||:.|:|||:||||||.|.||||||:..: |.|||||
  Fly   165 PAMLRAVELQIIEKSTCGAQYLTKDY-TVTDEMLCAGYLEGGKDTCNGDSGGPLAVD-GVLVGVV 227

  Fly   247 SWGYGCAKPDYPGVYSRVSFARDWIKEHS 275
            |||.||.:..:||||:.|:...|||:|.:
  Fly   228 SWGVGCGREGFPGVYTSVNSHIDWIEEQA 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 90/235 (38%)
Tryp_SPc 51..274 CDD:238113 92/237 (39%)
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 90/235 (38%)
Tryp_SPc 28..255 CDD:238113 92/237 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452488
Domainoid 1 1.000 185 1.000 Domainoid score I3316
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 1 1.000 - - FOG0000102
OrthoInspector 1 1.000 - - otm48708
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
109.860

Return to query results.
Submit another query.