DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and Ser8

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster


Alignment Length:271 Identity:105/271 - (38%)
Similarity:141/271 - (52%) Gaps:21/271 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LRLFVLLQCSLLVLAGVCLIPQPVKRQRSLEDVIKNPWKLSPRLDGRIVGGHRINITDAPHQVSL 68
            :.|.:....:||.|....:||..::.|.|             .|.||||||...:|.|.|.||||
  Fly     1 MSLLIATFLALLALTNGAVIPIGLEPQTS-------------SLGGRIVGGTASSIEDRPWQVSL 52

  Fly    69 QTS-SHICGGSIISEEWILTAAHC-TYGKTADRLKVRLGTSEFARSGQLLRVQKIVQHAQFNYTN 131
            |.| ||.|||||||...|:||||| ....|...|::|.|:::....|.|:.|..|..|..:|..:
  Fly    53 QRSGSHFCGGSIISNNIIVTAAHCLDTPTTVSNLRIRAGSNKRTYGGVLVEVAAIKAHEAYNSNS 117

  Fly   132 VDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSGWGNTQNLLESREWLRQVEVPLVN 196
            ...|..:::|...:.|..|.||:.:..:...:  |.|..:||||.|.....|...|..|:..:|.
  Fly   118 KINDIGVVRLKTKLTFGSTIKAITMASATPAH--GSAASISGWGKTSTDGPSSATLLFVDTRIVG 180

  Fly   197 QELCSEKYKQYGG-VTERMICAGFLEGGKDACQGDSGGPMVSESGELVGVVSWGYGCAKPDYPGV 260
            :..|......||. :...||||.  ...|||||||||||:|| .|:||||||||..||..:||||
  Fly   181 RSQCGSSTYGYGSFIKATMICAA--ATNKDACQGDSGGPLVS-GGQLVGVVSWGRDCAVANYPGV 242

  Fly   261 YSRVSFARDWI 271
            |:.::..|||:
  Fly   243 YANIAELRDWV 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 94/223 (42%)
Tryp_SPc 51..274 CDD:238113 94/224 (42%)
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 94/223 (42%)
Tryp_SPc 35..253 CDD:238113 93/222 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443368
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
76.860

Return to query results.
Submit another query.