DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and Prss37

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_038963710.1 Gene:Prss37 / 362346 RGDID:1311823 Length:249 Species:Rattus norvegicus


Alignment Length:237 Identity:58/237 - (24%)
Similarity:94/237 - (39%) Gaps:54/237 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 APHQVSLQTSSHICGGSIISEEWILTAAHCTYGKTADRLKVRLGT-SEFARSG--QLLRVQKIVQ 123
            ||:...|:::.:.|.|.:|...|:|..:||    ....|:|.||. ....|.|  |.:...:|::
  Rat    39 APYLAYLKSNFNPCVGVLIKASWVLAPSHC----YLPNLRVMLGNFKSRVRDGTEQTIYPIQIIR 99

  Fly   124 HAQFNYTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSG--WGNTQNLLESREW 186
            :..:::|....|..|::||.|..|:  .|...||.:......|..|.:||  |....|  .....
  Rat   100 YWNYSHTAPQDDLMLIKLAKPATFN--NKVQVLPIATTNVRPGTICTLSGLDWSQENN--GRHPD 160

  Fly   187 LRQ-VEVPLVNQELCSEKYK----------QYGGVTER---------MICAGFLEGGKDACQGDS 231
            ||| :|.|::..:.|.:..:          ::|.|..|         :||       |:..||..
  Rat   161 LRQNLEAPVMTDKDCQKTQQGSNHRNSLCVKFGKVFSRIFGEVAVATVIC-------KNKLQGIE 218

  Fly   232 GGPMVSESGELVGVVSWGYGCAKPDYPGVYSRVSFARDWIKE 273
            .|..:   |..||:           |..:||.|.:.....||
  Rat   219 VGHFM---GGDVGI-----------YTNIYSYVPWIEKTTKE 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 56/233 (24%)
Tryp_SPc 51..274 CDD:238113 58/237 (24%)
Prss37XP_038963710.1 Tryp_SPc 40..243 CDD:419748 55/231 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.