DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and gammaTry

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster


Alignment Length:268 Identity:108/268 - (40%)
Similarity:146/268 - (54%) Gaps:24/268 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLQCSLLVLAGVCLIPQPVKRQRSLEDVIKNPWKLSPRLDGRIVGGHRINITDAPHQVSLQTS-S 72
            :|:..:|:.|..|.:...|            |..|.|:||||||||....|:..|.|:|||.| |
  Fly     1 MLKFVILLSAVACALGGTV------------PEGLLPQLDGRIVGGSATTISSFPWQISLQRSGS 53

  Fly    73 HICGGSIISEEWILTAAHCTYGKTADRLKVRLGTSEFARSGQLLRVQKIVQHAQFNYTNVDYDFS 137
            |.|||||.|...|:|||||....:|..|::|.|:|.::..|....|.....|..:|...:..|.:
  Fly    54 HSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIA 118

  Fly   138 LLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSGWGNT---QNLLESREWLRQVEVPLVNQEL 199
            ::::...:.|..|.||:.|..|..  .:|.|..|||||..   .:.:.|:  |:.|.|.:|:|..
  Fly   119 IIKINGALTFSSTIKAIGLASSNP--ANGAAASVSGWGTLSYGSSSIPSQ--LQYVNVNIVSQSQ 179

  Fly   200 CSEKYKQYGG-VTERMICAGFLEGGKDACQGDSGGPMVSESGELVGVVSWGYGCAKPDYPGVYSR 263
            |:.....||. :...||||.  ..||||||||||||:|| .|.||||||||||||..:|||||:.
  Fly   180 CASSTYGYGSQIRSTMICAA--ASGKDACQGDSGGPLVS-GGVLVGVVSWGYGCAYSNYPGVYAD 241

  Fly   264 VSFARDWI 271
            |:..|.|:
  Fly   242 VAALRSWV 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 96/225 (43%)
Tryp_SPc 51..274 CDD:238113 96/226 (42%)
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 96/225 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443340
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
76.860

Return to query results.
Submit another query.