DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and kappaTry

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_610674.5 Gene:kappaTry / 36215 FlyBaseID:FBgn0043471 Length:263 Species:Drosophila melanogaster


Alignment Length:251 Identity:97/251 - (38%)
Similarity:134/251 - (53%) Gaps:33/251 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LSPRLDGRIVGGHRINITDAPHQVSLQ-------TSSHICGGSIISEEWILTAAHCTYGKTADRL 100
            :|.:.:|||:.|..::|...|:.|||:       :..|.|.|.||||:.::|:|.|.||...:..
  Fly    18 ISGQPEGRIINGTTVDIARHPYLVSLRYRRDNESSYMHECAGVIISEQALITSAQCLYGLPEETK 82

  Fly   101 KV-------RLGTSEFARSGQLLRVQKIVQHAQFNYTNVDYDFSLLQLAHPIKFDETKKAVKLPE 158
            .|       |.||..|     :..|.....|..::...||.|..:|.|      |.|.....|..
  Fly    83 LVAVAGANTRNGTDGF-----IYPVANWTHHPNYDPVTVDNDIGVLLL------DTTLDLTLLGI 136

  Fly   159 SQM-----KYMDGEACFVSGWGNTQNLLESREWLRQVEVPLVNQELCSEKYKQYGGVTERMICAG 218
            |.:     :...|....|:|||..:....|...|.|.|||:|:.|.|::.|.. |.|||||||||
  Fly   137 SSIGIRPERPAVGRLATVAGWGYREEWGPSSYKLEQTEVPVVSSEQCTQIYGA-GEVTERMICAG 200

  Fly   219 F-LEGGKDACQGDSGGPMVSESGELVGVVSWGYGCAKPDYPGVYSRVSFARDWIKE 273
            | ::||.||||||:|||:|.: |:|||:||||.|||:|:||.||..|:...|||:|
  Fly   201 FVVQGGSDACQGDTGGPLVID-GQLVGLVSWGRGCARPNYPTVYCYVASFVDWIEE 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 92/240 (38%)
Tryp_SPc 51..274 CDD:238113 94/243 (39%)
kappaTryNP_610674.5 Tryp_SPc 25..253 CDD:214473 92/240 (38%)
Tryp_SPc 26..256 CDD:238113 94/243 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443127
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.