DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and PRSS41

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001382429.1 Gene:PRSS41 / 360226 HGNCID:30715 Length:334 Species:Homo sapiens


Alignment Length:269 Identity:77/269 - (28%)
Similarity:120/269 - (44%) Gaps:69/269 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 PWKLSPRLDGRIVGGHRINITDAPHQVSLQTSSHICGGSIISEEWILTAAHC------------T 92
            ||:.|.||..|                      |.||||::|..|:|:||||            .
Human    83 PWQASLRLRRR----------------------HRCGGSLLSRRWVLSAAHCFQKHYYPSEWTVQ 125

  Fly    93 YGKTADR---LKVRLGTSEFARSGQLLRVQKIVQHAQFNYTNVD------YDFSLLQLAHPIKFD 148
            .|:...|   ..:|..:|.:       :||.|:       .|.|      .|.:||:||..:.::
Human   126 LGELTSRPTPWNLRAYSSRY-------KVQDII-------VNPDALGVLRNDIALLRLASSVTYN 176

  Fly   149 ETKKAVKLPESQMKYMDGEACFVSGWG---NTQNLLESREWLRQVEVPLVNQELCSEKYKQYGG- 209
            ...:.:.:..|...::....|:|:|||   .:...|.....||:.:|.::|...|:..::|... 
Human   177 AYIQPICIESSTFNFVHRPDCWVTGWGLISPSGTPLPPPYNLREAQVTILNNTRCNYLFEQPSSR 241

  Fly   210 --VTERMICAGFLEGGKDACQGDSGGPMVSESGEL---VGVVSWGYGCAKPDYPGVYSRVSFARD 269
              :.:.|.|||..:|..|.|:||||||:|.:...|   ||:||||..|.:|:.||||:.:|....
Human   242 SMIWDSMFCAGAEDGSVDTCKGDSGGPLVCDKDGLWYQVGIVSWGMDCGQPNRPGVYTNISVYFH 306

  Fly   270 WIK---EHS 275
            ||:   .||
Human   307 WIRRVMSHS 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 68/250 (27%)
Tryp_SPc 51..274 CDD:238113 69/255 (27%)
PRSS41NP_001382429.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.