DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and CG17571

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster


Alignment Length:236 Identity:97/236 - (41%)
Similarity:146/236 - (61%) Gaps:13/236 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 SPRLD---GRIVGGHRINITDAPHQVSLQTS--SHICGGSIISEEWILTAAHCTYGKTADRLKVR 103
            :|.||   ||||.|..::|.:.|:|||:||:  ||.||||:|..|.:||||||.....|..|:||
  Fly    21 NPGLDFPFGRIVNGEDVDIENYPYQVSVQTTKGSHFCGGSLIDSETVLTAAHCMQSYAASELQVR 85

  Fly   104 LGTSEFARSGQLLRVQKIVQHAQFNYTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEA 168
            :|::..:..|:::.|:....|..:|...:..|.::::|:.|::.....:|::|.:|:.  :.|..
  Fly    86 VGSTSRSSGGEVVTVRAFKYHEGYNSKLMINDVAIIKLSSPVRQTSKIRAIELADSEA--VSGTN 148

  Fly   169 CFVSGWGNTQNLL-ESREWLRQVEVPLVNQELCSEKYKQYG--GVTERMICAGFLEGGKDACQGD 230
            ..|||||.|..|. .|.:.|::|||.|::.:.|:.....||  .:.|.|:||  ....|||||||
  Fly   149 AVVSGWGTTCFLFCSSPDTLQKVEVDLLHYKDCAADTYNYGSDSILETMVCA--TGEKKDACQGD 211

  Fly   231 SGGPMVSESGELVGVVSWGYGCAKPDYPGVYSRVSFARDWI 271
            ||||:|::: :||||||||.|||...|||||:.|:..|.||
  Fly   212 SGGPLVADN-KLVGVVSWGSGCAWTGYPGVYADVASLRSWI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 91/225 (40%)
Tryp_SPc 51..274 CDD:238113 92/226 (41%)
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 91/225 (40%)
Tryp_SPc 31..254 CDD:238113 92/226 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443375
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
65.850

Return to query results.
Submit another query.