DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and Prss33

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_017173005.1 Gene:Prss33 / 353130 MGIID:2661234 Length:341 Species:Mus musculus


Alignment Length:345 Identity:112/345 - (32%)
Similarity:155/345 - (44%) Gaps:82/345 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLALRLFVLLQC---------SLLVLAGVCL-----IPQPVKR--------------QRSLEDVI 37
            ||...||..:|.         :.|.|..:||     :|.|.:|              |.|.||.:
Mouse     1 MLKASLFKAVQVRPQLRLGLDNYLGLHLLCLLSPQDLPWPHQREHQASRTRDQATCTQASSEDTM 65

  Fly    38 KNPWKL-------------------SPRLDGRIVGGHRINITDAPHQVSLQ-TSSHICGGSIISE 82
            :....|                   .||:..|||||......:.|.|.|:| ..:|:||||:|:.
Mouse    66 RGASHLQILLLLVLGTRMQECAACGQPRMSSRIVGGRDAQDGEWPWQTSIQHRGAHVCGGSLIAP 130

  Fly    83 EWILTAAHCTYGKTADRLKVRLGTSEFA----------RSGQ--LLRVQKIVQHAQFNYTNVDYD 135
            :|:|||.||        ...|:..||::          ||..  |:.|.:::....::......|
Mouse   131 QWVLTAGHC--------FPRRVWPSEYSVLLGALSLDVRSSHELLVPVLRVLLPPDYSEDEARGD 187

  Fly   136 FSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSGWGNTQ---NLLESREWLRQVEVPLVNQ 197
            .:||||.||:......:.|.||........|..|:|:|||:..   .|.:.|. |:.|.|||::.
Mouse   188 LALLQLRHPVSLSTRIQPVCLPAPGSHPPPGSPCWVTGWGSLSPGVPLPKGRP-LQGVRVPLLDS 251

  Fly   198 ELCSEKYKQYGGVT--ERMI-----CAGFLEGGKDACQGDSGGPMV-SESGE--LVGVVSWGYGC 252
            ..|...|.....|.  ||::     |||:..|.|||||||||||:. .|||.  ||||||||.||
Mouse   252 RACDRLYHVGANVPQGERIVLPGNLCAGYRRGHKDACQGDSGGPLTCMESGHWVLVGVVSWGKGC 316

  Fly   253 AKPDYPGVYSRVSFARDWIK 272
            |.|:.||||:.|:....||:
Mouse   317 ALPNRPGVYTNVAKYSPWIQ 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 91/246 (37%)
Tryp_SPc 51..274 CDD:238113 92/248 (37%)
Prss33XP_017173005.1 Tryp_SPc 98..336 CDD:238113 91/246 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.