DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and Phae1

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster


Alignment Length:282 Identity:83/282 - (29%)
Similarity:120/282 - (42%) Gaps:37/282 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LQCSLLVLAGVCLIPQPVKRQRSLEDVIKNPWKLSPRLDGRIVGGHRINITDAPHQVSLQ-TSSH 73
            |...||:|.|:|.|...         .|..|       :||:|||....:..||:.||:| ..:|
  Fly    11 LASGLLLLLGICRISGV---------AIGAP-------EGRVVGGSPAAVNSAPYAVSMQYGGTH 59

  Fly    74 ICGGSIISEEWILTAAHC------TYGKT--ADRLKVRLGTSEFARSGQLLRVQKIVQHAQFNYT 130
            .|..||::..|::|||||      ..|.|  |..:.|. ||   |.:.|...:...|.:..:...
  Fly    60 YCAASILNANWLVTAAHCLTNSNQVLGSTLVAGSIAVD-GT---ASTTQTRSITYFVINDLYTGG 120

  Fly   131 NVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSGWGNTQ--NLLESREWLR-QVEV 192
            .|.||..::.......:......|.||.|.:  :......:.|||:|.  |.......|: ...|
  Fly   121 TVPYDIGMIYTPTAFVWSAAVAPVTLPSSGV--VPTGTANLYGWGSTSTTNTASYPSTLQVATNV 183

  Fly   193 PLVNQELCSEKYKQYGG-VTERMICAGFLEGGKDACQGDSGGPMVSESGELVGVVSWG-YGCAKP 255
            |:::...|.......|. |....:|.|.|.||...|..|||||:| :...|:|:|||| ..|.:.
  Fly   184 PIISLSSCESALGTKGSDVHSTNLCTGPLTGGVSICTSDSGGPLV-QGNVLIGIVSWGKLPCGQA 247

  Fly   256 DYPGVYSRVSFARDWIKEHSGV 277
            :.|.||.:||....||..:..|
  Fly   248 NSPSVYVQVSSFISWISANQQV 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 70/234 (30%)
Tryp_SPc 51..274 CDD:238113 71/236 (30%)
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 70/234 (30%)
Tryp_SPc 36..266 CDD:238113 71/236 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.