DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and PRSS48

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_011530223.1 Gene:PRSS48 / 345062 HGNCID:24635 Length:351 Species:Homo sapiens


Alignment Length:250 Identity:85/250 - (34%)
Similarity:124/250 - (49%) Gaps:32/250 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 PRLDGRIVGGHRINITDAPHQVSLQ-TSSHICGGSIISEEWILTAAHC------TYGKTADRLKV 102
            |....|:|||........|.||||. ..:.|||||::||..|||||||      |:..|     |
Human    45 PVYSSRVVGGQDAAAGRWPWQVSLHFDHNFICGGSLVSERLILTAAHCIQPTWTTFSYT-----V 104

  Fly   103 RLGTSEFARSGQLLR--VQKIVQHAQFNYTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMD 165
            .||:.....|.:.::  |.|||.|.::..|..  |.:||:|:..:.|......:.||....:...
Human   105 WLGSITVGDSRKRVKYYVSKIVIHPKYQDTTA--DVALLKLSSQVTFTSAILPICLPSVTKQLAI 167

  Fly   166 GEACFVSGWGNTQNLLESREW---LRQVEVPLVNQELCSEKYKQYG--------GVTERMICAGF 219
            ...|:|:|||..:. ...|::   |::.|||:::::.|.:.|...|        .:.|..||||.
Human   168 PPFCWVTGWGKVKE-SSDRDYHSALQEAEVPIIDRQACEQLYNPIGIFLPALEPVIKEDKICAGD 231

  Fly   220 LEGGKDACQGDSGGPMVSESGEL---VGVVSWGYGCAKPDYPGVYSRVSFARDWI 271
            .:..||:|:||||||:......:   .||||||..|.| ..||||:.|.:.:.||
Human   232 TQNMKDSCKGDSGGPLSCHIDGVWIQTGVVSWGLECGK-SLPGVYTNVIYYQKWI 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 82/243 (34%)
Tryp_SPc 51..274 CDD:238113 82/243 (34%)
PRSS48XP_011530223.1 Tryp_SPc 50..285 CDD:214473 82/243 (34%)
Tryp_SPc 51..288 CDD:238113 82/243 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.