DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and Try29F

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster


Alignment Length:263 Identity:132/263 - (50%)
Similarity:172/263 - (65%) Gaps:12/263 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LVLAGVCLIPQPVKRQRSLEDVIKNPWKLSPRLDGRIVGGHRINITDAPHQVSLQTSSHICGGSI 79
            |.:.|:.|:      ..||...::.     ||||||||||...||.|.|:|||||.|.|.||||:
  Fly    17 LFIGGILLV------NLSLGATVRR-----PRLDGRIVGGQVANIKDIPYQVSLQRSYHFCGGSL 70

  Fly    80 ISEEWILTAAHCTYGKTADRLKVRLGTSEFARSGQLLRVQKIVQHAQFNYTNVDYDFSLLQLAHP 144
            |::.|:|||||||.|......|||:|:|..:..|||:.::::.:|.:|:...:|:|||||:|...
  Fly    71 IAQGWVLTAAHCTEGSAILLSKVRIGSSRTSVGGQLVGIKRVHRHPKFDAYTIDFDFSLLELEEY 135

  Fly   145 IKFDETKKAVKLPESQMKYMDGEACFVSGWGNTQNLLESREWLRQVEVPLVNQELCSEKYKQYGG 209
            ...:.|:..|.|||......||....||||||||:..|:...||.|.||.|:|..|:|.|..:|.
  Fly   136 SAKNVTQAFVGLPEQDADIADGTPVLVSGWGNTQSAQETSAVLRSVTVPKVSQTQCTEAYGNFGS 200

  Fly   210 VTERMICAGFLEGGKDACQGDSGGPMVSESGELVGVVSWGYGCAKPDYPGVYSRVSFARDWIKEH 274
            :|:||:|||..||||||||||||||:.:: |.|.||||||||||:|:|||||||||..||||...
  Fly   201 ITDRMLCAGLPEGGKDACQGDSGGPLAAD-GVLWGVVSWGYGCARPNYPGVYSRVSAVRDWISSV 264

  Fly   275 SGV 277
            ||:
  Fly   265 SGI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 118/220 (54%)
Tryp_SPc 51..274 CDD:238113 119/222 (54%)
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 118/220 (54%)
Tryp_SPc 42..264 CDD:238113 119/222 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443109
Domainoid 1 1.000 185 1.000 Domainoid score I3303
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 188 1.000 Inparanoid score I3890
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 1 1.000 - - FOG0000102
OrthoInspector 1 1.000 - - mtm6438
orthoMCL 1 0.900 - - OOG6_100031
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
1211.810

Return to query results.
Submit another query.