DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and PRSS53

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_011544118.1 Gene:PRSS53 / 339105 HGNCID:34407 Length:623 Species:Homo sapiens


Alignment Length:329 Identity:79/329 - (24%)
Similarity:140/329 - (42%) Gaps:90/329 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLVLAGVCLIPQPVK-RQRSLEDVIKNPWKLSPRLDGRIVGGHRINITDAPHQVSL-QTSSHICG 76
            :|::||..::.:.:: .||:...  :.|....|: :|..|.|      :.|.|.|: :..:|||.
Human     8 VLLIAGATVLMEGLQAAQRACGQ--RGPGPPKPQ-EGNTVPG------EWPWQASVRRQGAHICS 63

  Fly    77 GSIISEEWILTAAHCTYGKTADRL---KVRLGTSEFARSG-----QLLRVQKIVQHAQFNYTNVD 133
            ||::::.|:||||||.....|..|   .|.||:.:  |.|     :.:.|..:.....:|:.:..
Human    64 GSLVADTWVLTAAHCFEKAAATELNSWSVVLGSLQ--REGLSPGAEEVGVAALQLPRAYNHYSQG 126

  Fly   134 YDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSGWGNTQNLLESREW------------ 186
            .|.:|||||||    .|...:.||:...::..|.:|:.:||  .|:..:.:.|            
Human   127 SDLALLQLAHP----TTHTPLCLPQPAHRFPFGASCWATGW--DQDTSDGKCWPRLKLGEALCLP 185

  Fly   187 -----------------------------------LRQVEVPLVNQELCSEKYKQYGGVTER--- 213
                                               ||.:.:.|:::..|:..|.|   :.:|   
Human   186 SVTVSAPNCPGFQSPLLPRSQTLAPAPSLSPAPGTLRNLRLRLISRPTCNCIYNQ---LHQRHLS 247

  Fly   214 ------MICAGFLEGGKDACQGDSGGPM--VSESGELV--GVVSWGYGCAKPDYPGVYSRVSFAR 268
                  |:|.|...|.:..||||||||:  :...|..|  |::|:...||:.|.|.:.:..:...
Human   248 NPARPGMLCGGPQPGVQGPCQGDSGGPVLCLEPDGHWVQAGIISFASSCAQEDAPVLLTNTAAHS 312

  Fly   269 DWIK 272
            .|::
Human   313 SWLQ 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 70/289 (24%)
Tryp_SPc 51..274 CDD:238113 71/291 (24%)
PRSS53XP_011544118.1 Tryp_SPc 42..316 CDD:238113 71/290 (24%)
Tryp_SPc 43..314 CDD:214473 70/287 (24%)
Tryp_SPc 359..>512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149424
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.