DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and prss60.3

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_002662541.2 Gene:prss60.3 / 335152 ZFINID:ZDB-GENE-030131-7092 Length:330 Species:Danio rerio


Alignment Length:279 Identity:106/279 - (37%)
Similarity:146/279 - (52%) Gaps:35/279 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LQCSLLVLAGVCLIPQPVKRQRSLEDVIKNPWKLSPRLDGRIVGGHRINITDAPHQVSLQT---S 71
            |.|:.|.|. :|:       :.||..:  |....:| |:.|||||...:....|.||||.:   .
Zfish     6 LTCATLTLL-ICV-------KGSLSQL--NVCGQAP-LNTRIVGGVNASPGSWPWQVSLHSPKYG 59

  Fly    72 SHICGGSIISEEWILTAAHCTYGKTADRLKVRLGTS--------EFARSGQLLRVQKIVQHAQFN 128
            .|.||||:||.||:||||||..|.:...|.|.||..        |.:|:     |.|...|:.:|
Zfish    60 GHFCGGSLISSEWVLTAAHCLSGVSETTLVVYLGRRTQQGINIYETSRN-----VAKSFVHSSYN 119

  Fly   129 YTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSGWGNTQ---NLLESREWLRQV 190
            ....|.|.:||:|:..:.|....:.|.|......|..|.:.:::|||:.|   | |.:...|::.
Zfish   120 SNTNDNDIALLRLSSAVTFTNYIRPVCLAAQNSVYSAGTSSWITGWGDIQAGVN-LPAPGILQET 183

  Fly   191 EVPLVNQELCSEKYKQYGGVTERMICAGFLEGGKDACQGDSGGPMVSESGEL---VGVVSWGYGC 252
            .:|:|..:.|:..... |.||..|||||..:||||.||||||||||:....:   .|:.||||||
Zfish   184 MIPVVANDRCNALLGS-GTVTNNMICAGLTQGGKDTCQGDSGGPMVTRLCTVWVQAGITSWGYGC 247

  Fly   253 AKPDYPGVYSRVSFARDWI 271
            |.|:.||||:|||..:.||
Zfish   248 ADPNSPGVYTRVSQYQSWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 94/237 (40%)
Tryp_SPc 51..274 CDD:238113 95/238 (40%)
prss60.3XP_002662541.2 Tryp_SPc 36..269 CDD:238113 95/238 (40%)
Somatomedin_B 294..328 CDD:321959
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.