DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and CG4271

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_608665.1 Gene:CG4271 / 33410 FlyBaseID:FBgn0031409 Length:242 Species:Drosophila melanogaster


Alignment Length:206 Identity:68/206 - (33%)
Similarity:112/206 - (54%) Gaps:15/206 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 HICGGSIISEEWILTAAHCTYGKTADRLKVRLGTSEFARSGQLLRVQKIVQHAQFNYTNVDYDFS 137
            |.|||::|....:||||.|...|...|:.||:||.:..|.|:::||..:|.|.  ||.|.|.|.:
  Fly    42 HECGGAVIDSRIVLTAAQCVKNKPVKRITVRVGTPDIYRGGRIIRVTALVVHE--NYKNWDNDIA 104

  Fly   138 LLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSGWGNTQNLLESREWLRQVE---VPLVNQEL 199
            ||.|..|:.   :.:..|:|.:..:..:.|....:|||  :.||||....|:::   ..:..:.:
  Fly   105 LLWLEKPVL---SVRVTKIPLATKEPSENEYPSNAGWG--EKLLESYVVTRKLQNGVTKIRPRSM 164

  Fly   200 CSEKYKQYGGVTERMICAGFLEGGKDACQGDSGGPMVSESGELVGVVSWGYGCAKPDYPGVYSRV 264
            |:|:..:  .|.|.::||.:.|  .|.|.||.|||:|. :.::||:...|:||.....|.:|:.|
  Fly   165 CAEELVE--PVGEELLCAFYTE--NDICPGDYGGPLVL-ANKVVGIAVQGHGCGFAVLPSLYTNV 224

  Fly   265 SFARDWIKEHS 275
            ....:||:|::
  Fly   225 FHYLEWIEENA 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 65/200 (33%)
Tryp_SPc 51..274 CDD:238113 67/203 (33%)
CG4271NP_608665.1 Tryp_SPc 19..234 CDD:238113 67/203 (33%)
Tryp_SPc 19..231 CDD:214473 65/200 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.