DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and Ser6

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster


Alignment Length:264 Identity:87/264 - (32%)
Similarity:136/264 - (51%) Gaps:50/264 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 PWKLSP-RLDGRIVGGHRINITDAPHQVSLQTS-SHICGGSIISEEWILTAAHCTYGK------- 95
            |.:.:| :|:||:|||........||||||:.: ||.|||||::..:|||||||...:       
  Fly    20 PVQSAPGKLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTYILTAAHCVSNEDVNHVIT 84

  Fly    96 --TADRLKVRLGTSEFARSGQLLRVQKIVQHAQF-NYTNVDYDFSLLQLAHPIKFDETKKAVKLP 157
              .|:|..:|.|:::....|.|::|.:::.|.:: |:.|   |.:||:|..|:....:.:.:.||
  Fly    85 PIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYGNFLN---DVALLRLESPLILSASIQPIDLP 146

  Fly   158 ESQMKYMDGEA---CFVSGWGNTQNLLESREWLRQVEVPLVNQELCSEKYKQYGGVTERMICAGF 219
            .     :|..|   ..:||||..::..:...:|:...:..:.::.|           |.:|..||
  Fly   147 T-----VDTPADVDVVISGWGRIKHQGDLPRYLQYNTLKSITRQQC-----------EELIDFGF 195

  Fly   220 LEG--------GKDACQGDSGGPMVSESGELVGVVSWGY---GCAKPDYPGVYSRVSFARDWIKE 273
             ||        ...||.||||||.| .:.:||||.  |:   ||.. .||..|:||.:.:||||:
  Fly   196 -EGELCLLHQVDNGACNGDSGGPAV-YNNQLVGVA--GFVVDGCGS-TYPDGYARVFYFKDWIKK 255

  Fly   274 HSGV 277
            ||.|
  Fly   256 HSDV 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 77/245 (31%)
Tryp_SPc 51..274 CDD:238113 79/247 (32%)
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 77/245 (31%)
Tryp_SPc 32..256 CDD:238113 79/247 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.