DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and Prss53

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001074737.1 Gene:Prss53 / 330657 MGIID:2652890 Length:552 Species:Mus musculus


Alignment Length:284 Identity:76/284 - (26%)
Similarity:134/284 - (47%) Gaps:44/284 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLVLAGVCLIPQPVKRQRSLEDVIKNPWKLSPRLDGRIVGGHRINITDAPHQVSLQTSS-HICGG 77
            ||::..|.:|......||:...  :.|....|: :|..:.|      :.|.|.|::... |||.|
Mouse     9 LLIVGAVVVIEGLQAAQRACGQ--RGPGPPEPQ-EGNTLPG------EWPWQASVRRQGVHICSG 64

  Fly    78 SIISEEWILTAAHCTYGKTA----DRLKVRLGTSEFARSGQLLRVQKIVQHA-----QFNYTNVD 133
            |::::.|:|||||| :.|.|    ....|.||:  ..:.||....:::...|     .:|:.:..
Mouse    65 SLVADTWVLTAAHC-FEKMATAELSSWSVVLGS--LKQEGQSPGAEEVGVAALQLPKAYNHYSQG 126

  Fly   134 YDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSGWGNTQNLLESREWLRQVEVPLVNQE 198
            .|.:||||.||    ..:..:.||:....:..|.:|:.:||  .||..:....||.:.:.|:::.
Mouse   127 SDLALLQLTHP----TVQTTLCLPQPTYHFPFGASCWATGW--DQNTSDVSRTLRNLRLRLISRP 185

  Fly   199 LCSEKYKQYGGVTER---------MICAGFLEGGKDACQGDSGGPMVSESGE----LVGVVSWGY 250
            .|:..|.:   :.:|         |:|.|...|.:..||||||||::....:    .||::|:..
Mouse   186 TCNCLYNR---LHQRLLSNPARPGMLCGGAQPGEQGPCQGDSGGPVMCREPDGHWVQVGIISFTS 247

  Fly   251 GCAKPDYPGVYSRVSFARDWIKEH 274
            .||:.|.|.:.:.::....|::.|
Mouse   248 KCAQEDTPVLLTDMAVHSSWLQAH 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 65/243 (27%)
Tryp_SPc 51..274 CDD:238113 66/245 (27%)
Prss53NP_001074737.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..46 3/21 (14%)
Tryp_SPc 45..271 CDD:238113 66/243 (27%)
Tryp_SPc 311..522 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839483
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.