DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and Prss34

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_848459.1 Gene:Prss34 / 328780 MGIID:2681414 Length:318 Species:Mus musculus


Alignment Length:246 Identity:90/246 - (36%)
Similarity:133/246 - (54%) Gaps:26/246 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 IVGGHRINITDAPHQVSLQTS-------SHICGGSIISEEWILTAAHCTYGKTADR--LKVRLGT 106
            ||||..::.:..|.||||:..       .|.||||:|..:|:||||||...|..:.  ::|::|.
Mouse    35 IVGGCPVSASRFPWQVSLRLYDMEHSRWEHECGGSLIHPQWVLTAAHCVRPKEVEAYGVRVQVGQ 99

  Fly   107 SEFARSGQLLRVQKIVQHAQFN---YTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEA 168
            .....:.||::|.||::|.:|:   ......|.:||:|...:...|....|.||.:.::....:.
Mouse   100 LRLYENDQLMKVVKIIRHPKFSEKLSARGGADIALLKLDTRVVLSEHVYPVSLPAASLRISSKKT 164

  Fly   169 CFVSGWGNTQNL--LESREWLRQVEVPLVNQELCSEKYKQYGG-------VTERMICAGFLEGGK 224
            |:|:|||..:|.  |.....||:|.||:|....|.:||:....       :.:.|:|||  :.|:
Mouse   165 CWVAGWGVIENYMPLPPPYHLREVAVPIVENNDCEQKYQTNSSSDSTTRIIKDDMLCAG--KEGR 227

  Fly   225 DACQGDSGGPMVSE---SGELVGVVSWGYGCAKPDYPGVYSRVSFARDWIK 272
            |:|:.|||||:|..   |...|||||||.||..||:||||:||.....|||
Mouse   228 DSCKADSGGPLVCRWNCSWVQVGVVSWGIGCGLPDFPGVYTRVMSYVSWIK 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 87/243 (36%)
Tryp_SPc 51..274 CDD:238113 90/246 (37%)
Prss34NP_848459.1 Tryp_SPc 35..278 CDD:238113 88/244 (36%)
Tryp_SPc 35..277 CDD:214473 87/243 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.