DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and CG4653

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster


Alignment Length:244 Identity:72/244 - (29%)
Similarity:117/244 - (47%) Gaps:32/244 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 IVGGHRI--NITDAPHQVSLQTSS-HICGGSIISEEWILTAAHCT------YGKTADRLKVRLGT 106
            :|...|:  .:...||.:||:.:. |:|||::|.|:||||||||.      ....|....||:|:
  Fly    23 VVQSSRLPAEVGSQPHSISLRRNGVHVCGGALIREKWILTAAHCVSLGGGQQSYPAKSYNVRVGS 87

  Fly   107 SEFARSGQLLRVQKIVQHAQFNYTNVD----YDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGE 167
            .:....|||:.:.||:.|.  ||::.|    .|.:||:|...:..:.....:.|  :..:...|.
  Fly    88 IQRLTGGQLVPLSKIIIHT--NYSSSDAVGSNDLALLELETSVVLNANTNPIDL--ATERPAAGS 148

  Fly   168 ACFVSGWGNTQNLLESREWLRQVEV--PLVNQELCSEKYKQYGGVTERMICAGFL-EGGKDACQG 229
            ....||||::| :..|...:.||..  .|...:..:|.|.|    .|.::|...: |.....|.|
  Fly   149 QIIFSGWGSSQ-VDGSLSHVLQVATRQSLSASDCQTELYLQ----QEDLLCLSPVDEDFAGLCSG 208

  Fly   230 DSGGPMVSESGELVGVVSW---GYGCAKPDYPGVYSRVSFARDWIKEHS 275
            |:|.| .|.:.:|||:.::   |.|..:||   .|..|:...:||.|::
  Fly   209 DAGAP-ASYNNQLVGIAAFFVSGCGSEQPD---GYVDVTQHLEWINENA 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 69/238 (29%)
Tryp_SPc 51..274 CDD:238113 71/241 (29%)
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 69/234 (29%)
Tryp_SPc 30..249 CDD:214473 67/231 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.