DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and CG9673

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster


Alignment Length:246 Identity:74/246 - (30%)
Similarity:127/246 - (51%) Gaps:23/246 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 SPRLDGRIVGGHRINITDAPHQVSLQ-TSSHICGGSIISEEWILTAAHC--TYGKT---ADRLKV 102
            ||:  |||:||..:...:.|...|:: ..:|:|.|:|||...|||||||  :.|.|   |..|.|
  Fly    24 SPQ--GRILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHILTAAHCVSSVGITPVDASTLAV 86

  Fly   103 RLGTSEFARSGQLLRVQKIVQHAQFNYTNVDYDFSLLQLAHPIKFDETKKAVKLP---ESQMKYM 164
            ||||......|.::.|:.::.|.  :|.|..:|.::|:|...:.|.:..:.:.||   :.:.:.:
  Fly    87 RLGTINQYAGGSIVNVKSVIIHP--SYGNFLHDIAILELDETLVFSDRIQDIALPPTTDEETEDV 149

  Fly   165 D-----GEACFVSGWGNTQNLLESREWLRQVEVPLVNQELCSEKYKQYGGVTERMICAGFLEGGK 224
            |     |...:|:|||...:...|.: .::.....:::.|| |....||  .|.::|....| |:
  Fly   150 DAELPNGTPVYVAGWGELSDGTASYK-QQKANYNTLSRSLC-EWEAGYG--YESVVCLSRAE-GE 209

  Fly   225 DACQGDSGGPMVSESGELVGVVSWGYGCAKPDYPGVYSRVSFARDWIKEHS 275
            ..|:||:|..::.:...|.|:.|:.:|.....||.|.:|||:...||:.::
  Fly   210 GICRGDAGAAVIDDDKVLRGLTSFNFGPCGSKYPDVATRVSYYLTWIEANT 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 69/234 (29%)
Tryp_SPc 51..274 CDD:238113 70/236 (30%)
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 69/234 (29%)
Tryp_SPc 29..259 CDD:238113 70/236 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.