DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and sphe

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster


Alignment Length:254 Identity:73/254 - (28%)
Similarity:125/254 - (49%) Gaps:32/254 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LSPRL----------------DGRIVGGHRINITDAPHQVSLQT-SSHICGGSIISEEWILTAAH 90
            :.|||                .|||:||...:.|......||:. ::|:|||||:|:..|||.||
  Fly     2 MQPRLVILGLIGLTAVGMCHAQGRIMGGEDADATATTFTASLRVDNAHVCGGSILSQTKILTTAH 66

  Fly    91 CTY--GKTAD--RLKVRLGTSEFARSGQLLRVQKIVQHAQFNYTNVDYDFSLLQLAHPIKFDETK 151
            |.:  ||..|  ||..|:|::.....|:::.|:.:..|.  :|.|::.:.:::.|:..:.:.:..
  Fly    67 CVHRDGKLIDASRLACRVGSTNQYAGGKIVNVESVAVHP--DYYNLNNNLAVITLSSELTYTDRI 129

  Fly   152 KAVKLPES-QMKYMDGEACFVSGWGNTQNLLESREWLRQVEVPLVNQELCSEKYKQYGGVTERMI 215
            .|:.|..| :....:|....|:|||.|.:...|.: :||:.:.:..:..|.:.|..:   .|:..
  Fly   130 TAIPLVASGEALPAEGSEVIVAGWGRTSDGTNSYK-IRQISLKVAPEATCLDAYSDH---DEQSF 190

  Fly   216 C-AGFLEGGKDACQGDSGGPMVSESGELVGVVSWGYGCAKPDYPGVYSRVSFARDWIKE 273
            | |..|:.|  .|.||.||..: ....|:|:.::..|.....||.|:.|:|...|||:|
  Fly   191 CLAHELKEG--TCHGDGGGGAI-YGNTLIGLTNFVVGACGSRYPDVFVRLSSYADWIQE 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 66/227 (29%)
Tryp_SPc 51..274 CDD:238113 68/230 (30%)
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 64/214 (30%)
Tryp_SPc 42..244 CDD:214473 61/210 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.