DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and CG33160

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster


Alignment Length:239 Identity:81/239 - (33%)
Similarity:126/239 - (52%) Gaps:14/239 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 SPRLDGRIVGGHRINITDAPHQVSLQTSSHICGGSIISEEWILTAAHCTYGKTADRLKVRLGTSE 108
            |.::..||:|||..:|.:..:.|.:.||..:||||::...|::|||||.|.|..:..|:..|.|.
  Fly    27 SVQIQPRIIGGHVSSIKEEKYLVQVTTSEELCGGSLVKPRWVITAAHCVYNKNKNDFKIYGGASN 91

  Fly   109 FARSGQLLR-VQKIVQHAQFNYTNVDYDFSLLQLAHPIKFDETKKAVK-LPESQMKYMDGEACFV 171
            .|....::| |..|.....||...::.|.:.|:|    ..|.....:: :|.:...........|
  Fly    92 QAGPYAVIRTVDYIAIRPDFNRKTLNMDVAALRL----NSDMIGANIETIPLAAQSVPARALVKV 152

  Fly   172 SGWG-NTQNLLESREWLRQVEVPLVNQELCSEKYKQYGGVTERMICAGFLEGGKDACQGDSGGPM 235
            |||| .|.:..::.|.:..|.||:.::..|...::....:|..|:||..|. .||:|.||||||:
  Fly   153 SGWGFLTADATKTAERVHSVLVPMWSRASCVSAFRGIHRITRSMVCAARLY-KKDSCDGDSGGPL 216

  Fly   236 VSESGELVGVVSWGYGCAKPDYPGVYSRVSFARDW----IKEHS 275
            |.. |:|.|:||:|||||.. .||:|:.|...|||    :::||
  Fly   217 VYR-GQLAGIVSFGYGCASA-LPGIYTSVPEIRDWFQRVVEQHS 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 78/227 (34%)
Tryp_SPc 51..274 CDD:238113 77/229 (34%)
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 76/222 (34%)
Tryp_SPc 34..253 CDD:238113 77/225 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.