DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and CG33159

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster


Alignment Length:224 Identity:85/224 - (37%)
Similarity:125/224 - (55%) Gaps:10/224 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 RIVGGHRINITDAPHQVSLQTSSH-ICGGSIISEEWILTAAHCTYGKTADRLKVRLGTSEFARSG 113
            |||||....|::.|:.|.|:.:.: |||||:||...:|:||||.||...:...|..|.|...:..
  Fly    25 RIVGGKETTISEVPYLVYLRQNGYFICGGSLISSRAVLSAAHCVYGSQPEGFTVHAGASRLDQEA 89

  Fly   114 QLLRVQKIVQHAQFNY--TNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEA-CFVSGWG 175
            .::| ..::.|...:|  ||.|.|.:||||...:.....|.|...|.....  :|.| ..:||||
  Fly    90 PVVR-NVVMFHTSPSYSATNFDMDVALLQLQEVVVLTPGKVATISPCRNPP--EGNAYARISGWG 151

  Fly   176 NT-QNLLESREWLRQVEVPLVNQELCSEKYKQYGGVTERMICAGFLEGGKDACQGDSGGPMVSES 239
            .| :|..|..|.:|...|.::....|...|..||.:::.|:||. :.|.:|:|.||||||:|.. 
  Fly   152 VTRENNREPAEQVRTTMVRVLPGAECKISYSGYGQLSDSMLCAA-VRGLRDSCSGDSGGPLVYR- 214

  Fly   240 GELVGVVSWGYGCAKPDYPGVYSRVSFAR 268
            |::.|:||||:|||:|.:||||:.|:..|
  Fly   215 GQVCGIVSWGFGCARPSFPGVYTNVASER 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 85/224 (38%)
Tryp_SPc 51..274 CDD:238113 84/223 (38%)
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 84/220 (38%)
Tryp_SPc 26..251 CDD:238113 84/223 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D114140at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.