DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and CG31681

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster


Alignment Length:281 Identity:104/281 - (37%)
Similarity:149/281 - (53%) Gaps:41/281 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LALRLFVLLQCSLLVLAGVCLIPQPVKRQRSLEDVIKNPWKLSPRLDGRIVGGHRINITDAPHQV 66
            :.|||.:.:..|:..||....||.|                     :.|||||..|.|...|.||
  Fly     1 MCLRLLLSILVSIAGLACAARIPGP---------------------EERIVGGSYIPIEYVPWQV 44

  Fly    67 SLQTSS-HICGGSIISEEWILTAAHCTYGKTADRLKVRLGTSEFARSGQLLRVQKIVQHAQF--N 128
            |:|.:| |.|||.|.|:..|||||||....|...|.||.|:|.:::.||:|:|.|.:.|.::  .
  Fly    45 SVQNNSLHCCGGVIYSDRAILTAAHCLSNVTVTDLSVRAGSSYWSKGGQVLKVLKTIAHPKYVPK 109

  Fly   129 YTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSGWGNTQNLLESREW--LRQVE 191
            ..| .||.::|.|..|::...|.|  |:|.::...:.|.....||||.|:. ..|..|  |:.|.
  Fly   110 LYN-PYDIAVLILEAPLRLGGTVK--KIPLAEQTPVAGTIVLTSGWGYTRE-NSSFLWPILQGVH 170

  Fly   192 VPLVNQELCSEKYKQYGGVTERMICAGFLEGGK-DACQGDSGGPMV--SESG--ELVGVVSWGYG 251
            |.::|:..|.:.|| :..:|..||||   :|.: |.||||||||::  ::.|  :|:|:||||.|
  Fly   171 VAILNRTDCLKAYK-HVNITIDMICA---DGQRWDTCQGDSGGPLIETTKGGHRQLIGMVSWGDG 231

  Fly   252 CAKPDYPGVYSRVSFARDWIK 272
            |.  ..||||..::|..:|||
  Fly   232 CG--TNPGVYEDIAFFHNWIK 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 92/230 (40%)
Tryp_SPc 51..274 CDD:238113 94/232 (41%)
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 92/230 (40%)
Tryp_SPc 29..250 CDD:238113 92/230 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443333
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.