DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and CG32834

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001188996.1 Gene:CG32834 / 318238 FlyBaseID:FBgn0052834 Length:556 Species:Drosophila melanogaster


Alignment Length:248 Identity:83/248 - (33%)
Similarity:136/248 - (54%) Gaps:39/248 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 RIVGGHRINITDAPHQVS-LQTSSHICGGSIISEEWILTAAHC--TYGKTADRLKVRLGTS--EF 109
            ||:||:.::|.|||:|.. :...:.||.|:||:.:.|:|||.|  :||.    ::||:|||  ::
  Fly    26 RIIGGYDVDIEDAPYQAEVIIDGTAICSGAIITSDTIITAASCVQSYGS----IEVRVGTSSRDY 86

  Fly   110 ARSGQLLRVQKIVQHAQFNYTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSGW 174
            ..:|.||.|.:|:.|.|:|....|.:.:||:|..|:|..|..:.:.:.|.:..  ||..|.||||
  Fly    87 DGTGFLLEVCEIINHPQYNCWRFDNNLALLKLCDPLKTSEAIQPISIAEDEPD--DGSWCTVSGW 149

  Fly   175 GNTQ-----------NLLESREWLRQVEVPLVNQELC-SEKYKQYG----GVTERMICAGFLEGG 223
            |:|.           :|   .::|:...|.:.|:|.| :::...:|    |::...:|.   ..|
  Fly   150 GSTSWWGSWWDRCFGSL---PDYLQMAWVSVYNREQCAADRGVWFGLWDNGISYLTLCT---HNG 208

  Fly   224 KDACQGDSGGPMVSESGELVGVVSWGYGC-AKPDYPGVYSRVSFARDWIKEHS 275
            ...|..|:|.|:|.: |:|||::|.| || .|||   ||:.|.:...||.|::
  Fly   209 AGGCSYDTGAPLVID-GQLVGILSEG-GCTTKPD---VYANVPWFTGWIAENT 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 80/242 (33%)
Tryp_SPc 51..274 CDD:238113 81/244 (33%)
CG32834NP_001188996.1 Tryp_SPc 26..252 CDD:214473 80/242 (33%)
Tryp_SPc 27..255 CDD:238113 81/244 (33%)
BES1_N <293..343 CDD:283367
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.