DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and CG32755

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster


Alignment Length:293 Identity:103/293 - (35%)
Similarity:151/293 - (51%) Gaps:53/293 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLQCSLLVL--AGV--CLIPQPVKRQRSLEDVIKNPWKLSPRLDGRIVGGHRINITDAPHQVSLQ 69
            |..|.|:|.  :|:  ..|.||.        ...:|:.:.|    :||||:.:.|...|.|||::
  Fly     4 LWMCLLIVATHSGITQSQIGQPT--------ATASPFVILP----KIVGGYTVTIDQVPFQVSVR 56

  Fly    70 TSS---------HICGGSIISEEWILTAAHCTYGKTADRLKVR--------LGTSEFARSGQLLR 117
            ..|         |:|||::||:..:.:||||....|:..|..|        .|:|...|:.:..:
  Fly    57 RRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQ 121

  Fly   118 ---VQKIVQHAQFNYTNVDYDFSLLQLAHPIKFDE-----TKKAVKLPESQMKYMDGEACFVSGW 174
               ||:||.|..:|.:.::.|.:||.|...|.::.     ...|:|.||      :|..|.:.||
  Fly   122 EYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWESPGVRAIPLAIKAPE------EGTTCLIHGW 180

  Fly   175 GNTQNLLESREWLRQVEVPLVNQELCSEKYKQYGGVTERMICAGFLEGGKDACQGDSGGPMVSES 239
            |.. .:.|....|:|..||::|:|||...||    :....:|||||:||.||||||||||::.: 
  Fly   181 GKV-TMKEKSASLQQAPVPILNKELCQVIYK----LPASQMCAGFLQGGIDACQGDSGGPLICD- 239

  Fly   240 GELVGVVSWGYGCAKPDYPGVYSRVSFARDWIK 272
            |.|.|::|||.|||.|.|||||:.||....||:
  Fly   240 GRLAGIISWGVGCADPGYPGVYTNVSHFLKWIR 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 91/245 (37%)
Tryp_SPc 51..274 CDD:238113 93/247 (38%)
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 91/245 (37%)
Tryp_SPc 38..273 CDD:238113 93/247 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.