DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and CG32523

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster


Alignment Length:285 Identity:89/285 - (31%)
Similarity:136/285 - (47%) Gaps:43/285 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LFVLLQCSLLVLAGVCLIPQPVKRQRSLEDVIKNPWKLSPRLDGRIVGGHRINITDAPHQVSLQ- 69
            :.:||.|.:.|:.|              :||.:|  :....::.|||||.:......|||:||: 
  Fly     8 VLLLLLCGVQVILG--------------QDVAQN--QSESAIEPRIVGGIKAKQGQFPHQISLRL 56

  Fly    70 TSSHICGGSIISEEWILTAAHCT-YGK---TADRLKVRLGTSEFARSGQLLRVQKIVQHAQFNY- 129
            ...|.|||.|||...::||.||. :|.   .||...::.|:...:..|..:.|.:::.|.  || 
  Fly    57 RGEHYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHP--NYA 119

  Fly   130 TNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACF---VSGWGNTQNLLESREWLRQVE 191
            |....|.::|:|..|:.||....|::|...     |...|.   :|||||........:.|..|:
  Fly   120 TGGHNDLAVLRLQSPLTFDANIAAIQLATE-----DPPNCVAVDISGWGNIAEKGPLSDSLLFVQ 179

  Fly   192 VPLVNQELCSEKYKQYGGVTERMICAGFLEGGKD--ACQGDSGGPMVSESGELVGVVS--WGYGC 252
            |..:::..|  ::..|..:.|.|||   |...|:  ||.|||||| .:..|::||:.|  .|.||
  Fly   180 VTSISRGAC--RWMFYSRLPETMIC---LLHSKNSGACYGDSGGP-ATYGGKVVGLASLLLGGGC 238

  Fly   253 AKPDYPGVYSRVSFARDWIKEHSGV 277
            .:. .|..|.|:|..|.||.|.:|:
  Fly   239 GRA-APDGYLRISKVRAWIAEKAGL 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 77/233 (33%)
Tryp_SPc 51..274 CDD:238113 78/235 (33%)
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 77/233 (33%)
Tryp_SPc 37..219 CDD:238113 62/193 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.