DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and CG32376

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_729271.1 Gene:CG32376 / 318002 FlyBaseID:FBgn0052376 Length:291 Species:Drosophila melanogaster


Alignment Length:265 Identity:96/265 - (36%)
Similarity:146/265 - (55%) Gaps:28/265 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PQPVKRQRSLEDVIKNPW----KLSPRLDGRIVGGHRINITDAPHQVSLQTSSH-ICGGSIISEE 83
            |:.:....:..::..||:    :.......|||.|.||..|:||.|.||....: :||..||::.
  Fly    35 PEDIAPTPNFGNISSNPFINALEAQESFPTRIVNGKRIPCTEAPFQGSLHYEGYFVCGCVIINKI 99

  Fly    84 WILTAAHCTYGKTADRLKVRLGTSEFARSGQLLRVQKIVQHAQFNYTNVDYDFSLLQLAHPIKFD 148
            |||||.||.:| ..::..||:|:.:..|.|||..|:|||..|.:|...:.:|.::::|..|:.|.
  Fly   100 WILTAHHCFFG-PPEKYTVRVGSDQQRRGGQLRHVKKIVALAAYNDYTMRHDLAMMKLKSPVYFG 163

  Fly   149 ETKKAVKLPESQ-----MKYMDGEACFVSGWG----NTQNLLESREWLRQVEVPLVNQELCSEKY 204
            :..:.||||.::     .|::      |||||    |.||:   :.:||:|::..:.:..|.:.|
  Fly   164 KCVRPVKLPSTKTTKFPKKFV------VSGWGITSANAQNV---QRYLRRVQIDYIKRSKCQKMY 219

  Fly   205 KQYG-GVTERMICAGFLEGGKDACQGDSGGPMVSESGELVGVVSWGYGCAKPDYPGVYSRVSFAR 268
            |:.| .:.:.||||.  ...||:|.||||||:.|. |.|.|:||||.|||..:|||||.......
  Fly   220 KKAGLKIYKDMICAS--RTNKDSCSGDSGGPLTSR-GVLYGIVSWGIGCANKNYPGVYVNCKRYV 281

  Fly   269 DWIKE 273
            .|||:
  Fly   282 PWIKK 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 90/231 (39%)
Tryp_SPc 51..274 CDD:238113 92/234 (39%)
CG32376NP_729271.1 Tryp_SPc 65..284 CDD:214473 90/231 (39%)
Tryp_SPc 66..287 CDD:238113 92/234 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
43.910

Return to query results.
Submit another query.