DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and CG6041

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster


Alignment Length:261 Identity:90/261 - (34%)
Similarity:138/261 - (52%) Gaps:36/261 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 RLDGRIVGGHRINITDAPHQVSLQT---------SSHICGGSIISEEWILTAAHCTY------GK 95
            :::.:||||:..:|....:|||::.         |.|:|||.:||:..:.|||||.|      .:
  Fly    30 KIEPKIVGGYDASIEQVSYQVSIRLTANDKKSYGSGHLCGGVVISQRLVATAAHCCYITDKKKYR 94

  Fly    96 TADRLKVRLGTSEFARSGQ---LLRVQKIVQHAQFNYTNVDYDFSLLQLAHPIKFD-ETKKAVKL 156
            ||....:.:|::....|..   :..:|:::.|..:|...:..|.:|:.:...|.:: .|..|:.|
  Fly    95 TAGEFVLVMGSTYLTSSTDRTLMYYLQQLITHENYNPDALTNDIALMFINGYIPWNWPTVTALAL 159

  Fly   157 PESQMKYMDGEACFVSGWG-NTQNLLESREWLRQVEVPLVNQELCSEKYKQYGGVTERMICAGFL 220
             .||:...:.: |.:|||| ..||...|...|:...||:|:...|.   ..|..:....:|||:|
  Fly   160 -NSQLVATNTD-CLISGWGLLQQNGTFSSNTLQAATVPIVSYTTCR---ISYNSIPVSQVCAGYL 219

  Fly   221 EGGKDACQGDSGGPMVSESGELVGVVSWGYGCAKPDYPGVYSRVSFARDWIKE----------HS 275
            .||.||||||||||| |.:|.|.|:||:|.|||.|.|||||:.||:..|||.:          |:
  Fly   220 SGGVDACQGDSGGPM-SCNGMLAGIVSYGAGCAAPGYPGVYTNVSYYYDWIVQKNSSLNYTIYHN 283

  Fly   276 G 276
            |
  Fly   284 G 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 86/240 (36%)
Tryp_SPc 51..274 CDD:238113 88/252 (35%)
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 86/240 (36%)
Tryp_SPc 35..272 CDD:238113 88/242 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.