DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and Prtn3

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_038934901.1 Gene:Prtn3 / 314615 RGDID:1304898 Length:422 Species:Rattus norvegicus


Alignment Length:274 Identity:81/274 - (29%)
Similarity:111/274 - (40%) Gaps:40/274 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PQPVKRQRSLEDVIKNPWKLSPRLD---------------GRIVGGHRINITDAPHQVSLQTS-- 71
            |:|....|    |.::|...||||.               .:|||||.......|:..|||.|  
  Rat   160 PRPQLPPR----VSRSPIPRSPRLPCLRLAGVRFHGAVQASKIVGGHEARPHSRPYVASLQLSRS 220

  Fly    72 --SHICGGSIISEEWILTAAHCTYGKTADRLKVRLGTSEFARSGQLLRVQKIVQHAQFNYTNVD- 133
              ||.|||::|...::||||||....:...:.|.||..:...|....:...|.|..:.||...: 
  Rat   221 PGSHFCGGTLIHPRFVLTAAHCLQDISWQLVTVVLGAHDLLSSEPEQQKFTITQVFENNYNPEET 285

  Fly   134 -YDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSGWGNTQNLLESREWLRQVEVPLVNQ 197
             .|..||||..|....:......||:.......|..|...|||.......:...|.::.|.:|. 
  Rat   286 LNDVLLLQLNRPASLGKQVAVASLPQQDQSLSQGTQCLAMGWGRLGTRAPTPRVLHELNVTVVT- 349

  Fly   198 ELCSEKYKQYGGVTERMICAGFLEGGKDACQGDSGGPMVSESGELVGVVSWGY-GCAKPDYPGVY 261
            .||          .|..:|..........|.||||||::. :|.|.||.|:.. .||...:|..:
  Rat   350 FLC----------REHNVCTLVPRRAAGICFGDSGGPLIC-NGILHGVDSFVIRECASLQFPDFF 403

  Fly   262 SRVSFARDWIKEHS 275
            :|||...:||  ||
  Rat   404 ARVSMYVNWI--HS 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 68/227 (30%)
Tryp_SPc 51..274 CDD:238113 70/229 (31%)
Prtn3XP_038934901.1 Tryp_SPc 198..416 CDD:238113 72/232 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.